IGEM:MIT/2007/Ideas3: Difference between revisions

From OpenWetWare
Jump to navigationJump to search
Toan (talk | contribs)
Awlue (talk | contribs)
Line 18: Line 18:
==Mussel Protein==
==Mussel Protein==


Mgfp-5 Amino Acid Sequence
<pre>
1 sseeykggyy pgntyhyhsg gsyhgsgyhg gykgkyygka kkyyykykns gkykylkkar
61 kyhrkgykky ygggss
</pre>
/lue


==Water Purification Methods==
==Water Purification Methods==

Revision as of 05:00, 19 June 2007

Inbox

  • Put Links and Papers you find for another category here
  • Put your initials next to a link if you're in the process of analyzing it

Metal Pumps and Metal Specific Promoters

Mussel Protein

Expressing proteins on E coli cell membranes

Water Purification Methods

Metal Pumps and Metal Specific Promoters

Mussel Protein

Mgfp-5 Amino Acid Sequence

 1 sseeykggyy pgntyhyhsg gsyhgsgyhg gykgkyygka kkyyykykns gkykylkkar
61 kyhrkgykky ygggss

/lue

Water Purification Methods

OmpX

[J., Welch, R., Erickson, J.W., and Gross, C.A. 1995. Identification and characterization of an outer membrane protein, OmpX, in Escherichia coli that is homologous to a family of outer membrane proteins including Ail of Yersinia enterocolitica. J. Bacteriol. 177: 799–804.Acad. Sci. 98: 3750–3755. Wittrup, K.D. 2001. Protein engineering by cell-surface display. Curr. Opin. Biotechnol. 12: 395–399.]

[|OmpX sequence]

Sequence for CPX

  1. Native SS
     MKKIACLSALAAVLAFTAGTSVA 
  2. Embedded SfiI restriction site
     GQSGQ 
  3. Passenger Peptide
     XXXXXXXXXXXXXX 
  4. Sequence
     GGQSGQ  
  5. S54-F148
     SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF 
  6. Join native C and N
     GGSG 
  7. A1-S53
     ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS 

Papers!

  1. Samuelson P, Wernérus H, Svedberg M, and Ståhl S. Staphylococcal surface display of metal-binding polyhistidyl peptides. Appl Environ Microbiol. 2000 Mar;66(3):1243-8. DOI:10.1128/AEM.66.3.1243-1248.2000 | PubMed ID:10698802 | HubMed [Samuelson00]
  2. Kotrba P, Dolecková L, de Lorenzo V, and Ruml T. Enhanced bioaccumulation of heavy metal ions by bacterial cells due to surface display of short metal binding peptides. Appl Environ Microbiol. 1999 Mar;65(3):1092-8. DOI:10.1128/AEM.65.3.1092-1098.1999 | PubMed ID:10049868 | HubMed [Kotrba99]

All Medline abstracts: PubMed | HubMed