IGEM:IMPERIAL/2008/Prototype/Biomaterials: Difference between revisions
No edit summary |
No edit summary |
||
| (6 intermediate revisions by one other user not shown) | |||
| Line 1: | Line 1: | ||
{{Imperial/ | {{Imperial/StartPage2}}__NOTOC__ | ||
{{Imperial/Box2|Biomaterials| | |||
We aim to synthesize two types of biomaterials, elastin and EAK16-II 3D scaffolds.|}} | |||
{{Imperial/Box1|Elastin| | |||
Elastin is a polymeric extracellular matrix protein found in tissues that require the abitlity to extend as well as posses elastic recoil. Examples of elastin containing tissues include arteries, lungs, ligaments and skin. The precursor for elastin is a soluble protein called tropoelastin, consisting of alternating hydrophobic regions and crosslinking domains with distinct exons coding each domain. | Elastin is a polymeric extracellular matrix protein found in tissues that require the abitlity to extend as well as posses elastic recoil. Examples of elastin containing tissues include arteries, lungs, ligaments and skin. The precursor for elastin is a soluble protein called tropoelastin, consisting of alternating hydrophobic regions and crosslinking domains with distinct exons coding each domain. | ||
| Line 12: | Line 11: | ||
Unlike most proteins, which undergo denaturation when the temperature of the solution increases, elastin polypeptides become more ordered through coacervation. The temperature at which coacervation occurs is dependent on the relative proportions of hydrophobic and hydrophilic residues in the synthetic polypeptides as well as the ionic strength, pH and protein concentration of the solution. | Unlike most proteins, which undergo denaturation when the temperature of the solution increases, elastin polypeptides become more ordered through coacervation. The temperature at which coacervation occurs is dependent on the relative proportions of hydrophobic and hydrophilic residues in the synthetic polypeptides as well as the ionic strength, pH and protein concentration of the solution. | ||
[[Image:coacervation.JPG| | |[[Image:Elastin.JPG|300px|Construct EP20-24-24 for human elastin polypeptide]] | ||
[[Image:elastinchains.JPG|300px|Hydrophobic interactions and cross-linkages between adjacent EP chains]] | |||
[[Image:coacervation.JPG|300px|Dependence of coacervation on temperature and peptide concentration for EP20-24-24]]}} | |||
{{Imperial/Box1|EAK16-II| | |||
EAK16-II is a self-assembling peptide which forms stable β-sheet structures in water and exists naturally as a region in zuotin, a yeast protein. The amino acid sequence for EAK16-II is AEAEAKAKAEAEAKAK and has an estimated molecular mass of 1615.8. When examined under SEM, a well-ordered nanofibre structure is formed by the association of the EAK16-II proteins and these nanofibres can futher aggregate to form a membranous 3D scaffold. | EAK16-II is a self-assembling peptide which forms stable β-sheet structures in water and exists naturally as a region in zuotin, a yeast protein. The amino acid sequence for EAK16-II is AEAEAKAKAEAEAKAK and has an estimated molecular mass of 1615.8. When examined under SEM, a well-ordered nanofibre structure is formed by the association of the EAK16-II proteins and these nanofibres can futher aggregate to form a membranous 3D scaffold. | ||
The alternating positive and negative charges (--++--++) are responsible for creating an electrostatic attraction between adjacent peptides and self-assembly is triggered when the proteins are exposed to physiological media or salt solution. | The alternating positive and negative charges (--++--++) are responsible for creating an electrostatic attraction between adjacent peptides and self-assembly is triggered when the proteins are exposed to physiological media or salt solution. | ||
|[[Image:eak16.JPG|300px|Molecular structure of EAK16-II peptide]]}} | |||
{{Imperial/Box1|How ''B. subtilis'' can be used in producing material| | |||
B. subtilis can act as a cell factory producing and secreting proteins. Proteins can be secreted via three major pathways within the B. subtilis: Secretory signal recognition particle ('''Sec-SRP''') pathway, Twin-arginine translocation ('''Tat''') pathway and the ATP-binding cassette ('''ABC''') transporters. The Sec-SRP pathway would be more suitable in this case because it has been well studied in comparison to the two latter pathways. | |||
B.subtilis can act as a cell factory producing and secreting proteins. Proteins can be secreted via three major pathways within the B | |||
====== The process of Sec-SRP-dependent proteins secretion ====== | ====== The process of Sec-SRP-dependent proteins secretion ====== | ||
[[Image:signalpeptide.JPG|right|300px|Schematic representation of signal peptides for the Sec-SRP pathway in B. subtilis]] | |||
# SRP-protein targeting system to cell membrane | # SRP-protein targeting system to cell membrane | ||
# Sec protein translocation machinery across the cytoplasmic membrane | # Sec protein translocation machinery across the cytoplasmic membrane | ||
# Folding and release of protein | # Folding and release of protein | ||
====== Signal Peptides ====== | ====== Signal Peptides ====== | ||
Signal peptides are one of the major players in the production process of proteins. They are responsible for directing preproteins, a secretory protein with a signal peptide region attached, into a pathway. Its functions are to stop nascent chains mal-folding, recognising and submitting the peptide chain to the secretory machinery and to act as the topological determinant for preproteins in the membrane. In the case of the sec-type signal peptide, they direct pre-proteins from the cytoplasm into the growth medium. Although different signal peptides show little similarity in amino acid sequence, three distinct domains can be distinguished: a positively charged N-terminus (N-region), a central hydrophobic region (H-region) and a polar C-terminal region (C-region). The C-region commonly carries a type-I SPase cleavage site, with the consensus sequence Ala-X-Ala or Val-X-Ala at positions -1 and -3 relative to the cleavage site. | Signal peptides are one of the major players in the production process of proteins. They are responsible for directing preproteins, a secretory protein with a signal peptide region attached, into a pathway. Its functions are to stop nascent chains mal-folding, recognising and submitting the peptide chain to the secretory machinery and to act as the topological determinant for preproteins in the membrane. In the case of the sec-type signal peptide, they direct pre-proteins from the cytoplasm into the growth medium. Although different signal peptides show little similarity in amino acid sequence, three distinct domains can be distinguished: a positively charged N-terminus (N-region), a central hydrophobic region (H-region) and a polar C-terminal region (C-region). The C-region commonly carries a type-I SPase cleavage site, with the consensus sequence Ala-X-Ala or Val-X-Ala at positions -1 and -3 relative to the cleavage site. | ||
At present, about 60% of all commercially available enzymes are produced by Bacillus bacteria due to their huge capacity for secretion. Heterologous proteins that were successfully secreted by Bacillus bacteria include cutinase, α-amylase, proinsulin etc. | At present, about 60% of all commercially available enzymes are produced by Bacillus bacteria due to their huge capacity for secretion. Heterologous proteins that were successfully secreted by Bacillus bacteria include cutinase, α-amylase, proinsulin etc. | ||
| Line 47: | Line 47: | ||
''Epr'': MKNMSCKLVVSVTLFFSFLTIGPLAHAQNS | ''Epr'': MKNMSCKLVVSVTLFFSFLTIGPLAHAQNS | ||
== | <hr><br> | ||
Go back to the <html><a href="http://2008.igem.org/Team:Imperial_College/Chassis_1"></html>'''>>> Specifications Page >>>'''<html></a></html>|}} | |||
<hr><br clear="all"> | |||
{{Imperial/Box2|References| | |||
<biblio> | <biblio> | ||
#Elastin pmid=11738083 | #Elastin pmid=11738083 | ||
| Line 55: | Line 58: | ||
#ProteinSecretion pmid=16997527 | #ProteinSecretion pmid=16997527 | ||
#Proteomics pmid=10974125 | #Proteomics pmid=10974125 | ||
</biblio>|}} | |||
</biblio> | |||
Latest revision as of 14:46, 28 October 2008
<html> <style type="text/css"> .firstHeading {display: none;} </style> </html> <html> <style type="text/css">
table.calendar { margin:0; padding:2px; }
table.calendar td { margin:0; padding:1px; vertical-align:top; } table.month .heading td { padding:1px; background-color:#FFFFFF; text-align:center; font-size:120%; font-weight:bold; } table.month .dow td { text-align:center; font-size:110%; } table.month td.today { background-color:#3366FF } table.month td {
border:2px; margin:0; padding:0pt 1.5pt; font-size:8pt; text-align:right; background-color:#FFFFFF; }
- bodyContent table.month a { background:none; padding:0 }
.day-active { font-weight:bold; } .day-empty { color:black; } </style> </html>
| <html><script language="JavaScript">
var timeout = 250; var closetimer = 0; var ddmenuitem = 0; // open hidden layer function mopen(id) { // cancel close timer mcancelclosetime(); // close old layer if(ddmenuitem) ddmenuitem.style.visibility = 'hidden'; // get new layer and show it ddmenuitem = document.getElementById(id); ddmenuitem.style.visibility = 'visible'; } // close showed layer function mclose() { if(ddmenuitem) ddmenuitem.style.visibility = 'hidden'; } // go close timer function mclosetime() { closetimer = window.setTimeout(mclose, timeout); } // cancel close timer function mcancelclosetime() { if(closetimer) { window.clearTimeout(closetimer); closetimer = null; } } // close layer when click-out //document.onclick = mclose; </script> | ||||||||||||||||
| <html><style type="text/css">
div.Section { font:11pt/16pt Calibri, Verdana, Arial, Geneva, sans-serif; background-image: url(http://openwetware.org/images/a/a0/Background.PNG); background-size: 100%; background-origin: content; } /* Text (paragraphs) */ div.Section p { font:11pt/16pt Calibri, Verdana, Arial, Geneva, sans-serif; text-align:justify; margin-top:0px; margin-left:30px; margin-right:30px; } /* Headings */ div.Section h1 { font:22pt Calibri, Verdana, Arial, Geneva, sans-serif; text-align:left; color:#3366FF; font-weight:bold; } /* Subheadings */ div.Section h2 { font:18pt Calibri, Verdana, Arial, Geneva, sans-serif; color:#3366FF; margin-left:5px; font-weight:bold; } /* Subsubheadings */ div.Section h3 { font:22pt Calibri, Verdana, Arial, sans-serif; color:#E5EBFF; margin-left:10px; font-weight:bold; } /* Subsubsubheadings */ div.Section h4 { font:22pt Calibri, Verdana, Arial, sans-serif; color:#2B48B3; margin-left:10px; font-weight:bold; } /* Subsubsubsubheadings */ div.Section h5 { font:12pt Calibri, Verdana, Arial, sans-serif; color:#3366FF; margin-left:20px; } /* References */ div.Section h6 { font:12pt Calibri, Verdana, Arial, sans-serif; font-weight:bold; font-style:italic; color:#3366FF; margin-left:25px; } /* Hyperlinks */ div.Section a { } div.Section a:hover { } /* Tables */ div.Section td { font:11pt/16pt Calibri, Verdana, Arial, Geneva, sans-serif; text-align:justify; vertical-align:top; padding:2px 4px 2px 4px; } /* Lists */ div.Section li { font:11pt/16pt Calibri, Verdana, Arial, Geneva, sans-serif; text-align:left; margin-top:0px; margin-left:30px; margin-right:0px; } /* TOC stuff */ table.toc { margin-left:10px; } table.toc li { font: 11pt/16pt Calibri, Verdana, Arial, Geneva, sans-serif; text-align: justify; margin-top: 0px; margin-left:2px; margin-right:2px; } /* [edit] links */ span.editsection { color:#BBBBBB; font-size:10pt; font-weight:normal; font-style:normal; vertical-align:bottom; } span.editsection a { color:#BBBBBB; font-size:10pt; font-weight:normal; font-style:normal; vertical-align:bottom; } span.editsection a:hover { color:#3366FF; font-size:10pt; font-weight:normal; font-style:normal; vertical-align:bottom; } /* Drop-down Menu */
margin: 0; padding: 0; z-index: 30 margin: 0; padding: 0; float: center; font: bold 12pt Calibri, Verdana, Arial, Geneva, sans-serif; border: 0px; list-style: none; }
display: block; margin: 0px 0px 0px 0px; padding: 0 0 12px 0; color: #FFFFFF; text-align: center; text-decoration: none; }
border: 0px }
position: absolute; visibility: hidden; margin: 0; padding: 0; background: #66aadd; border: 1px solid #66aadd } #sddm div a { position: relative; left: 0; display: block; margin: 0; padding: 5px 10px; width: auto; white-space: nowrap; text-align: left; text-decoration: none; background: #FFFFFF; color: #2875DE; font: 11pt Calibri, Verdana, Arial, Geneva, sans-serif } #sddm div a:hover { background: #66aadd; color: #FFFFFF } </style></html>
| ||||||||||||||||