User:Mohammad H. Dezfulian: Difference between revisions

From OpenWetWare
Jump to navigationJump to search
No edit summary
 
(191 intermediate revisions by the same user not shown)
Line 1: Line 1:
{| cellspacing="2px" cellpadding="0" border="0" style="padding: 0px; width: 800px; color: #000000; background-color: #ffffff;"
{| cellspacing="2px" cellpadding="0" border="0" style="padding: 0px; width: 800px; color: #000000; background-color: #ffffff;"
|-valign="top"
|-valign="top"
|width=450px style="padding: 5px; background-color: #ffffff; border: 2px solid #228B22;" |
|width=450px style="padding: 5px; background-color: #ffffff; border: 2px solid #228B22;" |
<h3><font style="color:#006400;">Fluorescent Proteins </font></h3>
<br/>
==GFP==
>''' GFP''' (Aequoria victoria green fluorescent protein)


MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF
==Contact Info==
ICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNY
 
KTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFK
Mohammad Dezfulian  <br />
IRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTA
 
AGITHGMDELYK-
W: [https://scholar.harvard.edu/dezfulian Harvard Scholar]
 
== Patents ==
 
Methods And Compositions for Identifying Epitopes. '''''WO/2018/227091'''''
[https://patentscope2.wipo.int/search/en/detail.jsf;jsessionid=3D028A43ED54E7B9785DEEE9C247D1E8?docId=WO2018227091&recNum=17125&office=&queryString=&prevFilter=%26fq%3DOF%3AWO&sortOption=Pub+Date+Desc&maxRec=3449863 Link]
 
This patent describes the development of TScan-I and TScan-II platforms, which are the core innovations at TScan Therapeutics.
 
== Publications ==
 
[https://pubmed.ncbi.nlm.nih.gov/?term=%28%28%28%28Dezfulian%5BAuthor%5D+AND+Sardari%5BAuthor%5D%29+AND+%28Cheminformatics%5BTitle%5D%29%29+OR+%28Dezfulian%5BAuthor%5D+AND+Crosby%5BAuthor%5D%29%29+OR+%28Dezfulian%5BAuthor%5D+AND+Elledge%5BAuthor%5D%29%29+OR+%28Dezfulian+MH%5BAuthor%5D%29&sort=date Search Pubmed for an updated list of publications]
 
=== Peer Reviewed ===
1. Sardari, S. and '''Dezfulian, MH.''' (2005) Evaluation of SAR for Amphotericin B Derivatives by Artificial Neural Network. '''''Tropical Journal of Pharmaceutical Research''''' [https://www.dropbox.com/s/ooxc510zz33f8qb/14628-13779-1-PB.pdf?dl=0 PDF]
 
2. Sardari, S. and '''Dezfulian, MH.''' (2007) Cheminformatics in anti-infective agent discovery. '''''Mini Review in Medicinal Chemistry''''' [https://www.dropbox.com/s/qra84b8f71d7vfu/medicinal-chemistry2010.pdf?dl=0 PDF]
 
3. '''Dezfulian, MH.''' Soulliere, DM. Dhaliwal, RK. Sareen, M. Crosby, WL. (2012) The SKP1-Like Gene Family of Arabidopsis Exhibits a High Degree of Differential Gene Expression and Gene Product Interaction during Development. '''''Plos One''''', [http://www.plosone.org/article/fetchObject.action?uri=info%3Adoi%2F10.1371%2Fjournal.pone.0050984&representation=PDF Link]
 
4. Maleki, M. '''Dezfulian MH'''. Rueda, L.  A Computational Domain-Based Feature Grouping Approach for Prediction of Stability of SCF Ligases. (2015)'' '''Bioinformatics and Biomedical Engineering''''' [http://link.springer.com/chapter/10.1007/978-3-319-16483-0_61 Link]
 
5. Khalili, S. Rahbar, MR. '''Dezfulian, MH.''' Jahangiri, A. In silico analyses of Wilms’ tumor protein to designing a novel multi-epitope DNA vaccine against cancer. (2015) '''''Journal of Theoretical Biology''''' [http://linkinghub.elsevier.com/retrieve/pii/S0022-5193(15)00202-7 Link] [https://www.dropbox.com/s/e4ing2tgg6vi263/1-s2.0-S0022519315002027-main.pdf?dl=0 PDF]
 
6.      '''Dezfulian, MH.''' Jalili, E.  Roberto, D.K.A.  Moss, B.M. Khoo, K. Nemhauser, J.L. Crosby W.L.  Oligomerization of SCF TIR1 is essential for Aux/IAA degridation  and Auxin signaling in Arabidopsis. (2016) '''''PLoS Genetics''''' [http://journals.plos.org/plosgenetics/article?id=10.1371/journal.pgen.1006301  Link]
 
7.      '''Dezfulian, MH.'''  Foreman, C. Jalili, E.  Pal, M.  Dhaliwal, R. K.  Roberto, D.K. Crosby, W.L. Acetolactate synthase regulatory subunits play divergent and overlapping roles in branched-chain amino acid synthesis and Arabidopsis development. (2017) '''''BMC Plant Biology''''' [https://bmcplantbiol.biomedcentral.com/articles/10.1186/s12870-017-1022-6 Link]
 
8.      Kula T, '''Dezfulian MH''', Wang CI, Abdelfattah NS, Hartman ZC, Wucherpfennig KW, Lyerly HK, Elledge SJ: T-Scan: A Genome-wide Method for the Systematic Discovery of T Cell Epitopes. (2019) '''''Cell''''' [https://www.cell.com/cell/fulltext/S0092-8674(19)30774-3#secsectitle0070 Link]
 
Highlighted in [https://stm.sciencemag.org/content/11/506/eaaz0302 Science Translational Medicine] & [https://www.nature.com/articles/s41592-019-0599-0 Nature Methods] [https://www.sciencedirect.com/science/article/abs/pii/S1471490619302121 Trends in Immunology]
 
9. Meng Q, Xie S, Gray GK, '''Dezfulian MH''', Li W, Huang L, Akshinthala DC,Ferrer E, Conahan C, Del Pino SP, Grossman J, Elledge S, Hidalgo M, Muthuswamy SK. Empirical identification and validation of tumor-targeting T cell receptors from circulation using autologous pancreatic tumor organoids (2021) '''''Journal for Immunotherapy of Cancer '''''  [https://jitc.bmj.com/content/9/11/e003213 Link]
 
10. Naxerova K, Di Stefano B, Makofske JL, Watson EV, de Kort MA, Martin TD, '''Dezfulian MH''', Ricken D, Wooten EC, Kuroda MI, Hochedlinger K, Elledge SJ. Integrated loss- and gain-of-function screens define a core network governing human embryonic stem cell behavior. (2021)  '''''Genes and Development''''' [http://genesdev.cshlp.org/content/35/21-22/1527.abstract Link]
 
11.'''Dezfulian MH''', Kula T, Pranzatelli T, Kamitaki N, Meng Q, Khatri B, Perez P, Xu Q, Chang A, Kohlgruber AC, Leng Y, Jupudi A, Joachims ML, Chiorini JA, Lessard C, Farris AD, Muthuswamy S, Warner BA, Elledge SJ. TScan-II: A genome-scale platform for de novo identification of CD4+ T cell epitopes. (2023) '''''Cell'''''
 
Highlighted in [https://www.nature.com/articles/s41592-023-02156-8 Nature Methods] & [https://linkinghub.elsevier.com/retrieve/pii/S2667-2375(23)00380-6  Cell Reports Medicine] & Cancer Immunology Research
 
12. Kohlgruber, A.C., '''Dezfulian, M.H.''', Sie, B.M., Wang, C.I., Kula, T., Laserson, U., Larman, H.B. and Elledge, S.J. High-throughput discovery of MHC class I- and II-restricted T cell epitopes using synthetic cellular circuits (2024) '''''Nature Biotechnology'''''
 
=== Non Peer Reviewed ===
 
1. Sardari, S. and Dezfulian, MH. The Eastern Mediterranean Health Genomics and Biotechnology Network Critical for the Region. (2006) Genetic Engineering News [http://www.genengnews.com/keywordsandtools/print/1/11775/ Link]
 
==Academic Honors==
 
 
*2023 Poster presentation award at Salivary Glands and Exocrine Biology Gordon Research Conference, CA, USA
 
*2012 Conference Travel Award,University of Windsor, Department of Graduate Studies
 
*2011-2012 Graduate Student Society Award University of Windsor, Graduate Student Society                                                                                                                                  
 
*2010-2011 International Student Society Award University of Windsor, '' '''International student of the year award'' '''
 
*2009-2010 Department of Biological Sciences Graduate Excellence Award University of Windsor,'' '''Excellence in Research'''''
'''
 
*2008-2012 Graduate Excellence Scholarship University of Windsor, Department of Graduate Studies
 
*2008 Conference Travel Award University of Windsor, Department of Graduate Studies
 
 
==Fellowships==
 
 
*2012-2013 Queen Elizabeth II Graduate Scholarship in Science and Technology
*2008-2012 Agriculture and Agri-Food Canada Graduate Student Scholarship
*2006-2012 International Graduate Scholarship University of Windsor, Department of Graduate Studies
 
==Funding==
*Systemic Profiling of SCF E3 Ligase Regulatory Attributes at Play in Cell Cycle Control and Cancer (Co-investigator)
Seeds4Hope (2014-2016)
*Molecular Regulation of Auxin Signaling in Plant Development (Co-investigator)
NSERC (2015-2020)
 
*Mapping the specificity of CD4+ lymphocytes in Sjögren’s disease (Principle Investigator) 2022-2024
Sjögren’s Foundation High Impact Research Grant
 
== Conference Presentations & Proceedings ==
 
1. Bioactivity and chemical informatics of modeled microtubule inhibitors: Identification of key features and design of new agents in the treatment of cancer. (2005)  Sardari, S. '''Dezfulian, MH.'''
''TETRAHEDRON SYMPOSIUM 2005 Challenges in Organic Chemistry, Paris''
 
2. Synthetic strategies in protecting group selection and compound library design by informatics modeled group chemistry and neural networking. (2005) Sardari, S. Zolfaghari Jooya, H. '''Dezfulian MH.''' Omidi, M.
''TETRAHEDRON SYMPOSIUM 2005 Challenges in Organic Chemistry, Paris''
 
3. Molecular informatics, QSPR and computer modeling of microtubule inhibitors: Identification of key features and design of new agents in the treatment of tuberculosis. (2005) '''Dezfulian, MH.''' Sardari, S.
''34th International Scientific Meeting of the Directors of Pasteur Institute, Tehran''
 
4. QSPR modeling of Gyrase inhibitors of Trypanosoma: Identification of new agents. (2005) '''Dezfulian, MH.''' Jalili, E. Sardari, S.
''First National Congress on Molecular Microbiology Karaj''
 
5. A computer based model for anti Topoisomearse II compounds, a novel approach for evaluation of anti-cancer drugs. (2005) '''Dezfulian, MH.''' Jalili, E. Sardari, S.
''First International Congress of Biology & 13th National Congress of Biology, Rasht''
 
6. Artificial Neural Networks in Cheminformatics.* (2005) '''Dezfulian, MH.'''
''Research Day, Chamran, University of Ahvaz '' Invited Speaker


>''' GFP''' (Aequoria victoria green fluorescent protein)
7. Molecular Modelling of Methionyl-tRNA Synthetase Inhibitors in Staphylococcus aureus. (2005) Jalili, E. Dezfulian MH. Sardari, S.
''1st Student Conference of Biotechnology, Tehran ''


ATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTG
8. A screening study of hereditary nonpolyposis colorectal cancer (HNPCC), by Microsatellite marker analysis in Khorasan Province of Iran. (2006) Ahmadi, A.  Galehdari, H. '''Dezfulian, MH.'''
ATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATACGGAAA
''International Medical Genetic Conference, Kuwait'' 
ACTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACACTTGTC
ACTACTTTCTCTTATGGTGTTCAATGCTTTTCAAGATACCCAGATCATATGAAACGGCATG
ACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAAAGAACTATATTTTTCAAAGA
TGACGGGAACTACAAGACACGTGCTGAAGTCAAGTTTGAAGGTGATACCCTTGTTAATAGA
ATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTTGGACACAAATTGGAAT
ACAACTATAACTCACACAATGTATACATCATGGCAGACAAACAAAAGAATGGAATCAAAGT
TAACTTCAAAATTAGACACAACATTGAAGATGGAAGCGTTCAACTAGCAGACCATTATCAA
CAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCATTACCTGTCCACAC
AATCTGCCCTTTCGAAAGATCCCAACGAAAAGAGAGACCACATGGTCCTTCTTGAGTTTGT
AACAGCTGCTGGGATTACACATGGCATGGATGAACTATACAAATAG
==Venus YFP==


>'''mVenus Protein sequence''' (Venus YFP with monomerizing A206K mutation)
9. A Neural Network based model for evaluation of Anti-malarial Drugs. (2006) Sardari, S.  Galehdari, H. Jalili, E. Dezfulian, MH.
International Pharmaceutical Sciences Congress, Tehran


MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPT
10. Functional Analysis of SKP1 genes in Arabidopsis thaliana. (2008) '''Dezfulian, MH.''' Crosby, WL.
LVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTL
''19th International Conference on Arabidopsis Research , Montreal'' [https://www.arabidopsis.org/servlets/TairObject?type=publication&id=501728110 Abstract]
VNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLA
DHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK-


>'''mVenus DNA sequence''' (Venus YFP with monomerizing A206K mutation-720bp)
11. From Protein Complex to Supra-Complex. (2011)  Crosby, WL.  '''Dezfulian, MH.''' Dinatale, C.
''International Conference on Biomedical Ontology (ICBO), Buffalo, NY'' [http://icbo.buffalo.edu/2011/slides/Thursday%20Protein_Panel/protein-complex_crosby_v4_jul2011.pptx PPT]


ATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACG
12. E3-Ubiquitin Ligases as a Use-Case Scenario For Developing Quaternary Protein Complex Ontologies (2012) Crosby, WL.  Dezfulian, MH. Dinatale, C. ''Plant and Animal Genome XX Conference, San Diego'' [https://pag.confex.com/pag/xx/webprogram/Paper1868.html Abstract]
GCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGG
CAAGCTGACCCTGAAGCTGATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTC
GTGACCACCCTGGGCTACGGCCTGCAGTGCTTCGCCCGCTACCCCGACCACATGAAGCAGC
ACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAA
GGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAAC
CGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGG
AGTACAACTACAACAGCCACAACGTCTATATCACCGCCGACAAGCAGAAGAACGGCATCAA
GGCCAACTTCAAGATCCGCCACAACATCGAGGACGGCGGCGTGCAGCTCGCCGACCACTAC
CAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCT
ACCAGTCCAAGCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTT
CGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAA


==ECFP==
13. Identification of Ubiquitinated proteins in Arabidopsis thaliana using Protein Microarrays (2012) '''Dezfulian MH,''' Roberto DKA, Popescu SC, Crosby WL
>'''Enhanced CFP '''
''ICSB-2012 - The 13th International Conference on Systems Biology, Toronto, Canada''


MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPT
14. Ab initio Assembly, Annotation and Analysis of the Phaseolus var. OAC-REX Genome (2012) Dinatale C, Platts A, '''Dezfulian MH''', Perry G, Pauls KP,  Crosby WL
LVTTLTWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTL
''Phaseomics-The Genome conference, Guanajuato, Mexico'' [http://datos.langebio.cinvestav.mx/~aherrera/phaseomics/Abstract_Book.pdf Abstract]
VNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKANFKIRHNIEDGSVQLA
DHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK-


>'''Enhanced  CFP'''
15. Computational Analysis of Domain Interactions in Stability of Protein-protein Interactions (2014) Maleki M., '''Dezfulian MH''', Crosby WL, Rueda L.
''18th Annual International Conference on Research in Computational Molecular Biology, Pittsburgh, Pennsylvania'' [http://cdn.f1000.com/posters/docs/261044063 Poster]


ATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACG
16.  Computational Analysis of the Stability of SCF Ligases Employing Domain Information (2014) Maleki M.,Rueda L, '''Dezfulian MH'''., and Crosby WL,  ''5th ACM Conf. on Bioinformatics, Computational Biology and Health Informatics'' (ACMBCB), CA
GCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGG
CAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTC
GTGACCACCCTGACCTGGGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGC
ACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAA
GGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAAC
CGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGG
AGTACAACTACATCAGCCACAACGTCTATATCACCGCCGACAAGCAGAAGAACGGCATCAA
GGCCAACTTCAAGATCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTAC
CAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCA
CCCAGTCCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTT
CGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAA


==mCherry==
17. A Computational Domain-based Feature Grouping Approach for Prediction of Stability of SCF Ligases (2015)  Maleki, M.  '''Dezfulian, MH''' and Rueda L,  ''3rd Interanational Work-conference on Bioinformatics and Biomedical Engineering (IWBBIO)'', Granada, Spain,
>'''mCherry''' (Monomeric derivative of DsRed fluorescent protein)  


MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPF
18. Computational modeling of the effect of amino acid substitutions on the formation of Ubiquitin-based complexes (2015) Maleki, M.  '''Dezfulian, MH''' and Rueda L, 19th Annual International Conference on Research in Computational Molecular Biology, Warsaw, Poland [http://www.recomb2015.pl/accepted-posters Poster]
AWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGE
FIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVK
TTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK-


>'''mCherry''' (Monomeric derivative of DsRed fluorescent protein)
19. Identification of cognate antigens for clonally expanded T cells in Sjogren's disease (2023) '''Dezfulian, MH''' and Elledge SE, Salivary Glands and Exocrine Biology Gordon Research Conference, CA, USA [https://www.grc.org/salivary-glands-and-exocrine-biology-conference/2023/ Link]


ATGGTGAGCAAGGGCGAGGAGGATAACATGGCCATCATCAAGGAGTTCATGCGCTTCAAGG
20.Identification of CD4+ T cell antigens in Sjögren's disease.(2023)'''Dezfulian, MH''' and Elledge SE, CSHL Meeting: Systems Immunology, USA [https://meetings.cshl.edu/abstracts.aspx?meet=SYSIMM&year=23 Talk Link]
TGCACATGGAGGGCTCCGTGAACGGCCACGAGTTCGAGATCGAGGGCGAGGGCGAGGGCCG
CCCCTACGAGGGCACCCAGACCGCCAAGCTGAAGGTGACCAAGGGTGGCCCCCTGCCCTTC
GCCTGGGACATCCTGTCCCCTCAGTTCATGTACGGCTCCAAGGCCTACGTGAAGCACCCCG
CCGACATCCCCGACTACTTGAAGCTGTCCTTCCCCGAGGGCTTCAAGTGGGAGCGCGTGAT
GAACTTCGAGGACGGCGGCGTGGTGACCGTGACCCAGGACTCCTCCCTGCAGGACGGCGAG
TTCATCTACAAGGTGAAGCTGCGCGGCACCAACTTCCCCTCCGACGGCCCCGTAATGCAGA
AGAAGACCATGGGCTGGGAGGCCTCCTCCGAGCGGATGTACCCCGAGGACGGCGCCCTGAA
GGGCGAGATCAAGCAGAGGCTGAAGCTGAAGGACGGCGGCCACTACGACGCTGAGGTCAAG
ACCACCTACAAGGCCAAGAAGCCCGTGCAGCTGCCCGGCGCCTACAACGTCAACATCAAGT
TGGACATCACCTCCCACAACGAGGACTACACCATCGTGGAACAGTACGAACGCGCCGAGGG
CCGCCACTCCACCGGCGGCATGGACGAGCTGTACAAGTAG

Latest revision as of 19:45, 3 August 2024

Contact Info

Mohammad Dezfulian

W: Harvard Scholar

Patents

Methods And Compositions for Identifying Epitopes. WO/2018/227091 Link

This patent describes the development of TScan-I and TScan-II platforms, which are the core innovations at TScan Therapeutics.

Publications

Search Pubmed for an updated list of publications

Peer Reviewed

1. Sardari, S. and Dezfulian, MH. (2005) Evaluation of SAR for Amphotericin B Derivatives by Artificial Neural Network. Tropical Journal of Pharmaceutical Research PDF

2. Sardari, S. and Dezfulian, MH. (2007) Cheminformatics in anti-infective agent discovery. Mini Review in Medicinal Chemistry PDF

3. Dezfulian, MH. Soulliere, DM. Dhaliwal, RK. Sareen, M. Crosby, WL. (2012) The SKP1-Like Gene Family of Arabidopsis Exhibits a High Degree of Differential Gene Expression and Gene Product Interaction during Development. Plos One, Link

4. Maleki, M. Dezfulian MH. Rueda, L. A Computational Domain-Based Feature Grouping Approach for Prediction of Stability of SCF Ligases. (2015) Bioinformatics and Biomedical Engineering Link

5. Khalili, S. Rahbar, MR. Dezfulian, MH. Jahangiri, A. In silico analyses of Wilms’ tumor protein to designing a novel multi-epitope DNA vaccine against cancer. (2015) Journal of Theoretical Biology Link PDF

6. Dezfulian, MH. Jalili, E. Roberto, D.K.A. Moss, B.M. Khoo, K. Nemhauser, J.L. Crosby W.L. Oligomerization of SCF TIR1 is essential for Aux/IAA degridation and Auxin signaling in Arabidopsis. (2016) PLoS Genetics Link

7. Dezfulian, MH. Foreman, C. Jalili, E. Pal, M. Dhaliwal, R. K. Roberto, D.K. Crosby, W.L. Acetolactate synthase regulatory subunits play divergent and overlapping roles in branched-chain amino acid synthesis and Arabidopsis development. (2017) BMC Plant Biology Link

8. Kula T, Dezfulian MH, Wang CI, Abdelfattah NS, Hartman ZC, Wucherpfennig KW, Lyerly HK, Elledge SJ: T-Scan: A Genome-wide Method for the Systematic Discovery of T Cell Epitopes. (2019) Cell Link

Highlighted in Science Translational Medicine & Nature Methods Trends in Immunology

9. Meng Q, Xie S, Gray GK, Dezfulian MH, Li W, Huang L, Akshinthala DC,Ferrer E, Conahan C, Del Pino SP, Grossman J, Elledge S, Hidalgo M, Muthuswamy SK. Empirical identification and validation of tumor-targeting T cell receptors from circulation using autologous pancreatic tumor organoids (2021) Journal for Immunotherapy of Cancer Link

10. Naxerova K, Di Stefano B, Makofske JL, Watson EV, de Kort MA, Martin TD, Dezfulian MH, Ricken D, Wooten EC, Kuroda MI, Hochedlinger K, Elledge SJ. Integrated loss- and gain-of-function screens define a core network governing human embryonic stem cell behavior. (2021) Genes and Development Link

11.Dezfulian MH, Kula T, Pranzatelli T, Kamitaki N, Meng Q, Khatri B, Perez P, Xu Q, Chang A, Kohlgruber AC, Leng Y, Jupudi A, Joachims ML, Chiorini JA, Lessard C, Farris AD, Muthuswamy S, Warner BA, Elledge SJ. TScan-II: A genome-scale platform for de novo identification of CD4+ T cell epitopes. (2023) Cell

Highlighted in Nature Methods & Cell Reports Medicine & Cancer Immunology Research

12. Kohlgruber, A.C., Dezfulian, M.H., Sie, B.M., Wang, C.I., Kula, T., Laserson, U., Larman, H.B. and Elledge, S.J. High-throughput discovery of MHC class I- and II-restricted T cell epitopes using synthetic cellular circuits (2024) Nature Biotechnology

Non Peer Reviewed

1. Sardari, S. and Dezfulian, MH. The Eastern Mediterranean Health Genomics and Biotechnology Network Critical for the Region. (2006) Genetic Engineering News Link

Academic Honors

  • 2023 Poster presentation award at Salivary Glands and Exocrine Biology Gordon Research Conference, CA, USA
  • 2012 Conference Travel Award,University of Windsor, Department of Graduate Studies
  • 2011-2012 Graduate Student Society Award University of Windsor, Graduate Student Society
  • 2010-2011 International Student Society Award University of Windsor, International student of the year award
  • 2009-2010 Department of Biological Sciences Graduate Excellence Award University of Windsor, Excellence in Research

  • 2008-2012 Graduate Excellence Scholarship University of Windsor, Department of Graduate Studies
  • 2008 Conference Travel Award University of Windsor, Department of Graduate Studies


Fellowships

  • 2012-2013 Queen Elizabeth II Graduate Scholarship in Science and Technology
  • 2008-2012 Agriculture and Agri-Food Canada Graduate Student Scholarship
  • 2006-2012 International Graduate Scholarship University of Windsor, Department of Graduate Studies

Funding

  • Systemic Profiling of SCF E3 Ligase Regulatory Attributes at Play in Cell Cycle Control and Cancer (Co-investigator)

Seeds4Hope (2014-2016)

  • Molecular Regulation of Auxin Signaling in Plant Development (Co-investigator)

NSERC (2015-2020)

  • Mapping the specificity of CD4+ lymphocytes in Sjögren’s disease (Principle Investigator) 2022-2024

Sjögren’s Foundation High Impact Research Grant

Conference Presentations & Proceedings

1. Bioactivity and chemical informatics of modeled microtubule inhibitors: Identification of key features and design of new agents in the treatment of cancer. (2005) Sardari, S. Dezfulian, MH. TETRAHEDRON SYMPOSIUM 2005 Challenges in Organic Chemistry, Paris

2. Synthetic strategies in protecting group selection and compound library design by informatics modeled group chemistry and neural networking. (2005) Sardari, S. Zolfaghari Jooya, H. Dezfulian MH. Omidi, M. TETRAHEDRON SYMPOSIUM 2005 Challenges in Organic Chemistry, Paris

3. Molecular informatics, QSPR and computer modeling of microtubule inhibitors: Identification of key features and design of new agents in the treatment of tuberculosis. (2005) Dezfulian, MH. Sardari, S. 34th International Scientific Meeting of the Directors of Pasteur Institute, Tehran

4. QSPR modeling of Gyrase inhibitors of Trypanosoma: Identification of new agents. (2005) Dezfulian, MH. Jalili, E. Sardari, S. First National Congress on Molecular Microbiology Karaj

5. A computer based model for anti Topoisomearse II compounds, a novel approach for evaluation of anti-cancer drugs. (2005) Dezfulian, MH. Jalili, E. Sardari, S. First International Congress of Biology & 13th National Congress of Biology, Rasht

6. Artificial Neural Networks in Cheminformatics.* (2005) Dezfulian, MH. Research Day, Chamran, University of Ahvaz Invited Speaker

7. Molecular Modelling of Methionyl-tRNA Synthetase Inhibitors in Staphylococcus aureus. (2005) Jalili, E. Dezfulian MH. Sardari, S. 1st Student Conference of Biotechnology, Tehran

8. A screening study of hereditary nonpolyposis colorectal cancer (HNPCC), by Microsatellite marker analysis in Khorasan Province of Iran. (2006) Ahmadi, A. Galehdari, H. Dezfulian, MH. International Medical Genetic Conference, Kuwait

9. A Neural Network based model for evaluation of Anti-malarial Drugs. (2006) Sardari, S. Galehdari, H. Jalili, E. Dezfulian, MH. International Pharmaceutical Sciences Congress, Tehran

10. Functional Analysis of SKP1 genes in Arabidopsis thaliana. (2008) Dezfulian, MH. Crosby, WL. 19th International Conference on Arabidopsis Research , Montreal Abstract

11. From Protein Complex to Supra-Complex. (2011) Crosby, WL. Dezfulian, MH. Dinatale, C. International Conference on Biomedical Ontology (ICBO), Buffalo, NY PPT

12. E3-Ubiquitin Ligases as a Use-Case Scenario For Developing Quaternary Protein Complex Ontologies (2012) Crosby, WL. Dezfulian, MH. Dinatale, C. Plant and Animal Genome XX Conference, San Diego Abstract

13. Identification of Ubiquitinated proteins in Arabidopsis thaliana using Protein Microarrays (2012) Dezfulian MH, Roberto DKA, Popescu SC, Crosby WL ICSB-2012 - The 13th International Conference on Systems Biology, Toronto, Canada

14. Ab initio Assembly, Annotation and Analysis of the Phaseolus var. OAC-REX Genome (2012) Dinatale C, Platts A, Dezfulian MH, Perry G, Pauls KP, Crosby WL Phaseomics-The Genome conference, Guanajuato, Mexico Abstract

15. Computational Analysis of Domain Interactions in Stability of Protein-protein Interactions (2014) Maleki M., Dezfulian MH, Crosby WL, Rueda L. 18th Annual International Conference on Research in Computational Molecular Biology, Pittsburgh, Pennsylvania Poster

16. Computational Analysis of the Stability of SCF Ligases Employing Domain Information (2014) Maleki M.,Rueda L, Dezfulian MH., and Crosby WL, 5th ACM Conf. on Bioinformatics, Computational Biology and Health Informatics (ACMBCB), CA

17. A Computational Domain-based Feature Grouping Approach for Prediction of Stability of SCF Ligases (2015) Maleki, M. Dezfulian, MH and Rueda L, 3rd Interanational Work-conference on Bioinformatics and Biomedical Engineering (IWBBIO), Granada, Spain,

18. Computational modeling of the effect of amino acid substitutions on the formation of Ubiquitin-based complexes (2015) Maleki, M. Dezfulian, MH and Rueda L, 19th Annual International Conference on Research in Computational Molecular Biology, Warsaw, Poland Poster

19. Identification of cognate antigens for clonally expanded T cells in Sjogren's disease (2023) Dezfulian, MH and Elledge SE, Salivary Glands and Exocrine Biology Gordon Research Conference, CA, USA Link

20.Identification of CD4+ T cell antigens in Sjögren's disease.(2023)Dezfulian, MH and Elledge SE, CSHL Meeting: Systems Immunology, USA Talk Link