IGEM:MIT/2007/Ideas3: Difference between revisions
From OpenWetWare
Jump to navigationJump to search
| Line 30: | Line 30: | ||
==OmpX== | ==OmpX== | ||
[[http://www.pubmedcentral.nih.gov/picrender.fcgi?artid=176659&blobtype=pdf|Mecsas, J., Welch, R., Erickson, J.W., and Gross, C.A. 1995. Identification and characterization of an outer membrane protein, OmpX, in Escherichia coli that is homologous to a family of outer membrane proteins including Ail of Yersinia enterocolitica. J. Bacteriol. 177: 799–804.Acad. Sci. 98: 3750–3755. Wittrup, K.D. 2001. Protein engineering by cell-surface display. Curr. Opin. Biotechnol. 12: 395–399.]] | [[http://www.pubmedcentral.nih.gov/picrender.fcgi?artid=176659&blobtype=pdf |Mecsas, J., Welch, R., Erickson, J.W., and Gross, C.A. 1995. Identification and characterization of an outer membrane protein, OmpX, in Escherichia coli that is homologous to a family of outer membrane proteins including Ail of Yersinia enterocolitica. J. Bacteriol. 177: 799–804.Acad. Sci. 98: 3750–3755. Wittrup, K.D. 2001. Protein engineering by cell-surface display. Curr. Opin. Biotechnol. 12: 395–399.]] | ||
[[http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=559693 |OmpX sequence]] | [[http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=559693 |OmpX sequence]] | ||
Revision as of 13:16, 19 June 2007
Inbox
- Put Links and Papers you find for another category here
- Put your initials next to a link if you're in the process of analyzing it
Metal Pumps and Metal Specific Promoters
Mussel Protein
Expressing proteins on E coli cell membranes
Water Purification Methods
Metal Pumps and Metal Specific Promoters
Mussel Protein
Mgfp-5 Amino Acid Sequence
1 sseeykggyy pgntyhyhsg gsyhgsgyhg gykgkyygka kkyyykykns gkykylkkar 61 kyhrkgykky ygggss
/lue
Water Purification Methods
OmpX
Sequence for CPX
- Native SS
MKKIACLSALAAVLAFTAGTSVA
- Embedded SfiI restriction site
GQSGQ
- Passenger Peptide
XXXXXXXXXXXXXX
- Sequence
GGQSGQ
- S54-F148
SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
- Join native C and N
GGSG
- A1-S53
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS
Papers!
- Samuelson P, Wernérus H, Svedberg M, and Ståhl S. Staphylococcal surface display of metal-binding polyhistidyl peptides. Appl Environ Microbiol. 2000 Mar;66(3):1243-8. DOI:10.1128/AEM.66.3.1243-1248.2000 |
- Kotrba P, Dolecková L, de Lorenzo V, and Ruml T. Enhanced bioaccumulation of heavy metal ions by bacterial cells due to surface display of short metal binding peptides. Appl Environ Microbiol. 1999 Mar;65(3):1092-8. DOI:10.1128/AEM.65.3.1092-1098.1999 |