IGEM:IMPERIAL/2008/Bioprinter/Subteam 3: Difference between revisions

From OpenWetWare
Jump to navigationJump to search
Qin Qi (talk | contribs)
No edit summary
Qin Qi (talk | contribs)
No edit summary
Line 4: Line 4:


== Elastin ==
== Elastin ==
Elastin is a polymeric extracellular matrix protein found in tissues requiring extensibility and elastic recoil, including arteries, lungs, ligaments and skin. The precursor for elastin is a soluble protein called tropoelastin. The sequence of tropoelastin consists of alternating hydrophobic and crosslinking domains, with distinct exons coding each domain.
Hydrophobic domains are rich in glycine, valine, proline and other non-polar amino acids, often present in tandem peptide repeats. Crosslinking domains are rich in alanine and contain lysine residues, which form covalent crosslinks that stabilise the polymeric form of elastin.


[[Image:Elastin.JPG|right|thumb|Construct EP20-24-24 for human elastin polypeptide]]
[[Image:Elastin.JPG|right|thumb|Construct EP20-24-24 for human elastin polypeptide]]

Revision as of 08:30, 25 July 2008

Biomaterials

We aim to synthesize two types of biomaterials, elastin and EAK16-II 3D scaffolds.

Elastin

Elastin is a polymeric extracellular matrix protein found in tissues requiring extensibility and elastic recoil, including arteries, lungs, ligaments and skin. The precursor for elastin is a soluble protein called tropoelastin. The sequence of tropoelastin consists of alternating hydrophobic and crosslinking domains, with distinct exons coding each domain.

Hydrophobic domains are rich in glycine, valine, proline and other non-polar amino acids, often present in tandem peptide repeats. Crosslinking domains are rich in alanine and contain lysine residues, which form covalent crosslinks that stabilise the polymeric form of elastin.


Construct EP20-24-24 for human elastin polypeptide

EAK16-II

Molecular structure of EAK16-II peptide

AEAEAKAKAEAEAKAK

Signalling Peptides

SacB: MNIKKFAKQATVLTFTTALLAGGATQAFAKET

LipA: MKFVKRRIIALVTILMLSVTSLFALQPSAKAAEH

Epr: MKNMSCKLVVSVTLFFSFLTIGPLAHAQNS