IGEM:IMPERIAL/2008/Bioprinter/Subteam 3: Difference between revisions
No edit summary |
No edit summary |
||
| Line 4: | Line 4: | ||
== Elastin == | == Elastin == | ||
Elastin is a polymeric extracellular matrix protein found in tissues requiring extensibility and elastic recoil, including arteries, lungs, ligaments and skin. The precursor for elastin is a soluble protein called tropoelastin. The sequence of tropoelastin consists of alternating hydrophobic and crosslinking domains, with distinct exons coding each domain. | |||
Hydrophobic domains are rich in glycine, valine, proline and other non-polar amino acids, often present in tandem peptide repeats. Crosslinking domains are rich in alanine and contain lysine residues, which form covalent crosslinks that stabilise the polymeric form of elastin. | |||
[[Image:Elastin.JPG|right|thumb|Construct EP20-24-24 for human elastin polypeptide]] | [[Image:Elastin.JPG|right|thumb|Construct EP20-24-24 for human elastin polypeptide]] | ||
Revision as of 08:30, 25 July 2008
Biomaterials
We aim to synthesize two types of biomaterials, elastin and EAK16-II 3D scaffolds.
Elastin
Elastin is a polymeric extracellular matrix protein found in tissues requiring extensibility and elastic recoil, including arteries, lungs, ligaments and skin. The precursor for elastin is a soluble protein called tropoelastin. The sequence of tropoelastin consists of alternating hydrophobic and crosslinking domains, with distinct exons coding each domain.
Hydrophobic domains are rich in glycine, valine, proline and other non-polar amino acids, often present in tandem peptide repeats. Crosslinking domains are rich in alanine and contain lysine residues, which form covalent crosslinks that stabilise the polymeric form of elastin.
EAK16-II
AEAEAKAKAEAEAKAK
Signalling Peptides
SacB: MNIKKFAKQATVLTFTTALLAGGATQAFAKET
LipA: MKFVKRRIIALVTILMLSVTSLFALQPSAKAAEH
Epr: MKNMSCKLVVSVTLFFSFLTIGPLAHAQNS
