Chris Rhodes Week 8: Difference between revisions

From OpenWetWare
Jump to navigationJump to search
No edit summary
No edit summary
Line 10: Line 10:
  RSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLRE
  RSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLRE
  QFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFN
  QFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFN
*From the list of gp160 proteins found when searching for gp120 in the first step 5 sequences were chosen to be used in the mass retrieval exercise. The UniProt ID numbers of the 5 sequences are P04578, P03377, P03375, P35961, and P05877. From the options for downloading the sequences I chose the FASTA format, this combined sequence FASTA file can be found [[Media:CHR_Fasta1_20111019.fasta | here]
*From the list of gp160 proteins found when searching for gp120 in the first step 5 sequences were chosen to be used in the mass retrieval exercise. The UniProt ID numbers of the 5 sequences are P04578, P03377, P03375, P35961, and P05877. From the options for downloading the sequences I chose the FASTA format, this combined sequence FASTA file can be found [[Media:CHR_Fasta1_20111019.fasta | here]]


==HIV Structure Project==
==HIV Structure Project==

Revision as of 22:08, 19 October 2011

For today's lab we will working out of the Bioinformatics for Dummies 2nd edition book performing selected activities from Chapters 2, 4, 5, and 6 but modifying the protocols to apply to the current website formats and the use of HIV-1 gp120.

In Class Activities

Retrieving Protein Sequences

  • The protein retrieved in this exercise is HIV-1 gp120. It was found by going to ExPASy and searching "HIV gp120 envelope protein" using the UniProtKB database, but verified independent gp120 protein could not be found. The gp120 protein sequence was instead taken from an entry of gp160 which contains the gp120 sqeuence. The UniProtKB entry of the gp160 protein used is found hereand the sequence of the gp120 protein, shown as the highlighted residues within the gp160 protein sequence, is found here http://www.uniprot.org/blast/?about=P04578[33-511] -> This address couldn't be properly hyperlinked due to the [33-511] text causing problems with the linking format.
  • The fasta form of the gp120 protein sequence was retrieved from the entry page and is shown here:
>sp|P04578|33-511
KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISL
WDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSY
KLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVI
RSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLRE
QFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFN
  • From the list of gp160 proteins found when searching for gp120 in the first step 5 sequences were chosen to be used in the mass retrieval exercise. The UniProt ID numbers of the 5 sequences are P04578, P03377, P03375, P35961, and P05877. From the options for downloading the sequences I chose the FASTA format, this combined sequence FASTA file can be found here

HIV Structure Project

  1. Chris Rhodes User Page
  2. Week 2 Journal
  3. Week 3 Journal
  4. Week 4 Journal
  5. Week 5 Journal
  6. Week 6 Journal
  7. Week 7 Journal
  8. Week 8 Journal
  9. Week 9 Journal
  10. Week 10 Journal
  11. Week 11 Journal
  12. Week 12 Journal
  13. Week 13 Journal
  14. Week 14 Journal
  15. Home Page
  16. Week 5 Assignment Page
  17. Week 6 Assignment Page
  18. Week 7 Assignment Page
  19. Week 8 Assignment Page
  20. Week 9 Assignment Page
  21. Week 10 Assignment Page
  22. Week 11 Assignment Page
  23. Week 12 Assignment Page
  24. Week 13 Assignment Page
  25. Week 14 Assignment Page