Proportal Strains

From OpenWetWare
Revision as of 21:47, 19 December 2011 by Huiming Ding (talk | contribs)
Jump to navigationJump to search

Strain Discussion

More new genomes coming

The 96 .gbk files on the Darwin cluster are at:/scratch/kashtan/Annotated/BATS_ALL/

Another batch of genomes

All of the new genomes are on Darwin, at /home/sbiller/newgenomes... in there are subdirectories for the FASTA files of contigs, the RAST annotation genbank files, and the amino acid sequences as determined by RAST.


MIT-9312

Case closed.

P-SSP6

Here is a feature that needed to be added to the genome of the phage P-SSP6.

    gene            complement(33508..33801)
                    /locus_tag="PRUG_00040a"
                    /note="Manually added and annotated 09-15-11 by SJL"
    CDS             complement(33508..33801)
                    /locus_tag="PRUG_00040a"
                    /codon_start=1
                    /transl_table=11
                    /product="High light inducible protein"
                    /protein_id="CAMERA-phage:PRUG_00040aT0"
                    /translation="EEVSRLAARTVHRHRHANLSFFQMVTTEYGKQNIFATEPQVQVL
                    TMDNENAEIQKWPLGYGRILGGHRCLCHHRTNHSWNLLNLIFFNDNSHTNKTK"
                    /note="Manually added and annotated 09-15-11 by SJL"

The GenBank file of P-SSP6 is attached.


P-SSS3

Here's the Broad FTP for P-SSS3, there's no Genbank file but there is some annotation:

ftp://ftp.broadinstitute.org/BIN/Annotation/broadAnnotation/20100304-dataRelease/P-SSS3/