IGEM:Imperial/2010/Output module: Difference between revisions
(N- or C- terminus of C23O) |
No edit summary |
||
(5 intermediate revisions by 2 users not shown) | |||
Line 1: | Line 1: | ||
{{Imperial2010/Header}} | |||
{| class="wikitable" style="text-align: center; width: 50%; height: 170px;" border="1" | {| class="wikitable" style="text-align: center; width: 50%; height: 170px;" border="1" | ||
Line 185: | Line 186: | ||
Catechol 2,3-dioxygenase (also known as C23O or MPC) catalyses the conversion of a colourless substrate (catechol or substituted catechols) into a bright yellow product (2-hydroxymuconic semialdehyde) within seconds of substrate addition. | Catechol 2,3-dioxygenase (also known as C23O or MPC) catalyses the conversion of a colourless substrate (catechol or substituted catechols) into a bright yellow product (2-hydroxymuconic semialdehyde) within seconds of substrate addition. | ||
C23O is a homotetramer and its crystal structure has been solved. See | C23O is a homotetramer and its crystal structure has been solved. See [http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6VSR-4CXCWS0-8&_user=217827&_coverDate=01%2F15%2F1999&_rdoc=1&_fmt=high&_orig=search&_sort=d&_docanchor=&view=c&_acct=C000011279&_version=1&_urlVersion=0&_userid=217827&md5=da4c70ba15ab6920ba7b6ec6cebb34cf Kita et al] or use the accession code 1mpy. | ||
C23O has also been expressed successfully in B. subtilis by | C23O has also been expressed successfully in B. subtilis by [http://www.ncbi.nlm.nih.gov/pmc/articles/PMC393536/?tool=pubmed Zukowski et al]. | ||
We would make a fusion protein by adding, for example, GST to either the C- or N- terminus. This would hopefully prevent oligomerisation until the TEV protease is activated. TEV would specifically cleave the linker between GST and C23O, resulting in C23O monomers that are capable of oligomerising. Homotetramers would then be active and could catalyse the chromogenic reaction. | We would make a fusion protein by adding, for example, GST to either the C- or N- terminus. This would hopefully prevent oligomerisation until the TEV protease is activated. TEV would specifically cleave the linker between GST and C23O, resulting in C23O monomers that are capable of oligomerising. Homotetramers would then be active and could catalyse the chromogenic reaction. | ||
Line 194: | Line 195: | ||
However, it is further away from the oligomerisation interfaces and so might not actually prevent oligomerisation. | However, it is further away from the oligomerisation interfaces and so might not actually prevent oligomerisation. | ||
The C-terminus, on the other hand, is less accessible, but fusing GST there could prevent entry of the substrate into the funnel that runs through the enzyme. It is also closer to the oligomerisation domain and so fusing GST here is more likely to prevent oligomerisation. | The C-terminus, on the other hand, is less accessible, but fusing GST there could prevent entry of the substrate into the funnel that runs through the enzyme. It is also closer to the oligomerisation domain and so fusing GST here is more likely to prevent oligomerisation. | ||
However, when we looked at C23O in Pymol, we noticed that the N-termini were probably closer to the oligomerisation interfaces (see below). Also, we were also worried that we might still get dimerisation if we used the N-terminus for our fusion protein. However, [http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6VSR-4CXCWS0-8&_user=217827&_coverDate=01%2F15%2F1999&_rdoc=1&_fmt=high&_orig=search&_sort=d&_docanchor=&view=c&_acct=C000011279&_version=1&_urlVersion=0&_userid=217827&md5=da4c70ba15ab6920ba7b6ec6cebb34cf Kita et al] show that the projecting loop is needed for dimerisation, and this is very near to the N-terminus. | |||
[[Image:Tetramer of C23O.PNG]] | |||
The C23O gene is already part of a BioBrick (Part:BBa_K118021). | |||
==James- some suggested papers:== | ==James- some suggested papers:== | ||
Line 211: | Line 219: | ||
* [http://pubs.acs.org/doi/full/10.1021/ac010717k Protein Splicing-Based Reconstitution of Split Green Fluorescent Protein for Monitoring Protein−Protein Interactions in Bacteria: Improved Sensitivity and Reduced Screening Time] | * [http://pubs.acs.org/doi/full/10.1021/ac010717k Protein Splicing-Based Reconstitution of Split Green Fluorescent Protein for Monitoring Protein−Protein Interactions in Bacteria: Improved Sensitivity and Reduced Screening Time] | ||
* [http://pubs.acs.org/doi/full/10.1021/ac000617z A Fluorescent Indicator for Detecting Protein−Protein Interactions in Vivo Based on Protein Splicing] | * [http://pubs.acs.org/doi/full/10.1021/ac000617z A Fluorescent Indicator for Detecting Protein−Protein Interactions in Vivo Based on Protein Splicing] | ||
==Possible Outputs and their pros and cons== | |||
{| class="wikitable" style="text-align: center; width: 50%; height: 170px;" border="1" | |||
|- | |||
! Output !! Substrate !! Pros !!Cons | |||
|- | |||
| Split β-lactamase | |||
| | |||
*Cephalosporin | |||
* Flourocilin green | |||
| | |||
* Cheap | |||
* β-lac tested and shown to work | |||
* Ceph kills cells | |||
* Visible colour output | |||
| | |||
* Lyses cells | |||
* Quantification difficult | |||
|- | |||
| Split Luciferase | |||
| Luciferin | |||
| | |||
* Quantification | |||
| | |||
* Poor expression | |||
* Expensive | |||
* Lyses cells | |||
|- | |||
| Split TEV | |||
| | |||
* C230-dihydrogenase | |||
| | |||
* Fast | |||
* Visible colour output (yellow) | |||
* In registry | |||
* Works in B.Sub | |||
* Cheap substrate | |||
| | |||
* TEV not tested in coils | |||
* Protein engineering | |||
|- | |||
| Split TEV | |||
| | |||
* FRET pair | |||
| | |||
* Fast | |||
* Established | |||
| | |||
* TEV not tested in coils | |||
* No visible colour - florescence | |||
|- | |||
| Split TEV | |||
| | |||
* EGFP | |||
| | |||
* Fast | |||
* Ratiometric | |||
| | |||
* TEV not tested in coils | |||
* Low output | |||
|} |
Latest revision as of 09:12, 23 September 2010
<html>
<head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.2/jquery.min.js"></script> <script type="text/javascript"> $(document).ready(function(){
$(function(){
var path = location.pathname.substring(1); if ( path ) $('#headover ul li a[href$="' + path + '"]').addClass("curlink").css("color","#ea8828");; var vCurlink = $('#headover ul li a[href$="' + path + '"]').attr("id"); $('#'+vCurlink+'.listhead').addClass('curlink').css("color","#444444");
});
$('#menuback').mouseover(function() {
$('#headover').stop().animate({height:'150px',top:'0px'},1000);
});
$('#menu').mouseleave(function() {
$('.listhead').not('.curlink').css("color","#ffffff"); $('.listmain').not('.curlink').css("color","#dddddd"); $('#headover ul').fadeOut(200); $('#headover').stop().animate({height:'50px',top:'100px'},1000);
});
$('.listhead').mouseover(function(){
$('.listhead').not('.curlink').css("color","#ffffff"); $(this).css("color","#444444"); $('#headover ul').css("display","none"); var vActive = $(this).attr("id"); $('.'+vActive).stop().fadeIn(200);
});
$('.listmain').mouseover(function(){
$('.listmain').not('.curlink').css("color","#dddddd"); $(this).css("color","#ea8828");
});
$('#headover').mouseleave(function(){
$('.listmain').not('.curlink').css("color","#dddddd");
});
}); </script> <style type="text/css">
.firstHeading { display: none;}
#content { width: 900px; font-family: helvetica, arial, sans-serif; color: #555555}
#title { width:900px; height:50px; position: relative; top: 0px; left: 0px;}
#implogo { width:190px; height:50px; position: absolute; top: 0px; left: 20px; background-image:url(http://openwetware.org/images/c/c9/Imperialigemimplogo.jpg);}
#igemlogo { width:84px; height:50px; position:absolute; top:0px; left:260px; background-image:url(http://openwetware.org/images/9/9c/Imperialigemigemlogo.jpg);}
#csynbilogo { width:205px; height:50px; position:absolute; top:0px; left:394px; background-image:url(http://openwetware.org/images/a/ac/Imperialigemcsynbilogo.jpg);}
#menu { width:900px; height:150px; position: relative; top: 20px; left: 0px;}
#menuback { width:100px; height:150px; position: absolute; top: 0px; left: 0px; background-color: #ea8828}
#headpic { width:800px; height:150px; position: absolute; top: 0px; left: 100px; background-image: url('http://openwetware.org/images/5/54/Imperialigemheadone.jpg'); }
#headover { width: 800px; height:50px; position: absolute; top: 100px; left: 0px; background: url(http://openwetware.org/images/d/d8/Imperialigemheadoverone.png) 0px 0px no-repeat; }
a { outline:none;}
#headtit{ font-family: helvetica, arial, sans-serif; font-size: 1.2em; color: #ffffff; position: absolute; top: 0.5em; right: 1.4em;}
.dark{ color: #dddddd;}
.highlight{ color: #ea8828;}
#menulist{ position: absolute; top: 16px; left: 3px; list-style: none;}
#menulist li{ height: 30px; }
#menulist li a{ font-weight: 100; font-size: 1.2em; text-decoration: none; font-family: helvetica, arial, sans-serif; color: #ffffff;}
#headover ul{ list-style: none; display: none; position: absolute; top: 1.2em; left: 0.2em; }
#headover ul ul{ position: absolute; top:-0.2em; left: 15em;}
#headover ul li{ height: 2.4em; }
#headover ul li a{ font-weight: 100; font-size: 1.2em; text-decoration: none; font-family: helvetica, arial, sans-serif; color: #dddddd;}
</style> </head> <body> <div id='title'> <div id='implogo'> </div> <div id='igemlogo'> </div> <div id='csynbilogo'> </div> </div> <div id='menu'> <div id='menuback'> <ul id='menulist'> <li><a href='#' class='listhead' id='project'>Project</a></li> <li><a href='#' class='listhead' id='plan'>Plan</a></li> <li><a href='#' class='listhead' id='results'>Results</a></li> <li><a href='#' class='listhead' id='extra'>Extra</a></li> </ul> </div> <div id='headpic'> <div id='headover'> <p id='headtit'>Parasight<span class='dark'> <span class='highlight'>|</span> Parasite detection with a rapid response</span></p> <ul class='project'> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010' class='listmain' id='project'>Overview</a></li> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Detection_module' class='listmain' id='project'>Detection Module</a></li> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Fast_Response_module' class='listmain' id='project'>Fast Response Module</a></li> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Output_module' class='listmain' id='project'>Output Module</a></li> <ul class='project'> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Ethics' class='listmain' id='project'>Ethics</a></li> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Parts' class='listmain' id='project'>Parts</a></li> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Papers' class='listmain' id='project'>Papers</a></li> </ul> </ul> <ul class='plan'> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Strategy' class='listmain' id='plan'>Strategy</a></li> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Parts/Synthesis' class='listmain' id='plan'>Synthesis</a></li> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Lab_Work' class='listmain' id='plan'>Lab Work</a></li> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Protocol' class='listmain' id='plan'>Protocol</a></li> <ul class='plan'> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Modelling' class='listmain' id='plan'>Modelling</a></li> </ul> </ul> <ul class='results'> <li><a href='#' class='listmain' id='results'>Under Construction</a></li> </ul> <ul class='extra'> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Projects' class='listmain' id='extra'>Brainstorming</a></li> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Journal_Club' class='listmain' id='extra'>Journal Club</a></li> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Movie_Night' class='listmain' id='extra'>Movie Night</a></li> <li><a href='http://openwetware.org/wiki/IGEM:Imperial/2010/Judging_Criteria' class='listmain' id='extra'>Judging Criteria</a></li> </ul> </div> </div> </div> </body>
</html> <html>
<head> <style type="text/css"> #blank { height:40px; width: 900px; </style> </head> <body> <div id="blank"> </div> </body>
</html>
Effector 1 (Protease) | Effector 2 (Dye,Enz) | Pigment biosynthetic pathways |
---|---|---|
transcr sigma 54 | 2 colourless | Bilins |
Activation (phosphorylation) | Enz-in-pathway
|
Anthocyanins
|
Target proteases to use
|
Protein scaffold | Fret pairs as back up for effectors |
2C DNA binding prot release |
This review article has some useful information on FRET.
Our autoinhibitory coiled-coil output constructs
Taken and adapted from the JACS article 'An Autoinhibited Coiled-Coil Design Strategy for Split-Protein Protease Sensors' ref
The construct design is of the order:
A’-TEV-B-NFluc Cfluc-A-TEV-B‘2A
Where in our case NFluc and CFluc will be NBlactamase CBlactamase//split eGFP and split TEV itself. The 2A refers to a mutated variation of the original coil sequence (AQLKKKLQANKKELAQLKWKLQALKKKLAQ)which produced a better coil activity.
AQLEKELQALEKKLAQLEWENQALEKELAQ (A')
gcgcagctggaaaaagaactgcaggcgctggaaaaaaaactggcgcagctggaatgggaa aaccaggcgctggaaaaagaactggcgcag
AQAKKKAQANKKELAQLKWKLQALKKKLAQ (B'2A)
gcgcaggcgaaaaaaaaagcgcaggcgaacaaaaaagaactggcgcagctgaaatggaaa ctgcaggcgctgaaaaaaaaactggcgcag
Tobacco etch virus (TEV) protease-cleavable linker (GGGGENLYFQGGKLGGGG)was used.
ggcggcggcggcgaaaacctgtattttcagggcggcaaactgggcggcggcggc LINKER
Overall sequence for Coiled-coil construct
C-TERMINAL sGFP/sB-Lac -GGGSGGGSGGGS-AQLEKELQALEKKLAQLEWENQALEKELAQGGGGENLYFQGGKLGGGGAQAKKKAQANKKELAQLKWKLQALKKKLAQ
ggcggcggcagcggcggcggcagcggcggcggcagcgcgcagctggaaaaagaactgcaggcgctggaaaaaaaactggcgcagctggaatgggaa aaccaggcgctggaaaaagaactggcgcagggcggcggcggcgaaaacctgtattttcag ggcggcaaactgggcggcggcggcgcgcaggcgaaaaaaaaagcgcaggcgaacaaaaaa gaactggcgcagctgaaatggaaactgcaggcgctgaaaaaaaaactggcgcag
AQLEKELQALEKKLAQLEWENQALEKELAQGGGGENLYFQGGKLGGGGAQLKKKLQANKKELAQLKWKLQALKKKLAQ-GGGSGGGSGGGS-N-TERMINAL sGFP/sB-Lac
gcgcagctggaaaaagaactgcaggcgctggaaaaaaaactggcgcagctggaatgggaa aaccaggcgctggaaaaagaactggcgcagggcggcggcggcgaaaacctgtattttcag ggcggcaaactgggcggcggcggcgcgcagctgaaaaaaaaactgcaggcgaacaaaaaa gaactggcgcagctgaaatggaaactgcaggcgctgaaaaaaaaactggcgcagggcggcggcagcggcggcggcagcggcggcggcagc
(GGGS)3 is the flexible linker between the split protease/enzyme and the coil!!
Beta-Lactamase construct
NβLac-A-TEV-B’4A βLactamase (26-196)(Glu) TEV B-CβLac βLactamase (Leu)(198-290)
LacB from pQE32 plasmid [[1]]
Showing sequences for the B-Lactamase, the sequences are split into the two halves with the gap in the middle.
Protein 286aa MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMAttlrklltg
ellt
LASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Nucleotide
atgagcattcagcattttcgcgtggcgctgattccgttttttgcggcgttttgcctgccggtgtttgcgcatccggaaaccctggtgaaagtgaaagatgcggaagatcagctgggcgcgcgcgtgggctatattgaactggatctgaacagcggcaaaattctggaaagctttcgcccggaagaacgctttccgatgatgagcacctttaaagtgctgctgtgcggcgcggtgctgagccgcattgatgcgggccaggaacagctgggccgccgcattcattatagccagaacgatctggtggaatatagcccggtgaccgaaaaacatctgaccgatggcatgaccgtgcgcgaactgtgcagcgcggcgattaccatgagcgataacaccgcggcgaacctgctgctgaccaccattggcggcccgaaagaactgaccgcgtttctgcataacatgggcgatcatgtgacccgcctggatcgctgggaaccggaactgaacgaagcgattccgaacgatgaacgcgataccaccatgccggtggcgatggcgaccaccctgcgcaaactgctgaccggc
gaactgctgacc
ctggcgagccgccagcagctgattgattggatggaagcggataaagtggcgggcccgctgctgcgcagcgcgctgccggcgggctggtttattgcggataaaagcggcgcgggcgaacgcggcagccgcggcattattgcggcgctgggcccggatggcaaaccgagccgcattgtggtgatttataccaccggcagccaggcgaccatggatgaacgcaaccgccagattgcggaaattggcgcgagcctgattaaacattgg
fluorocilin green (Invitrogen) was used as the fluorescing substrate.
Split luciferase
entire seq:
Luciferase [Photinus pyralis] GenBank: AAA29795.1
can be obtained from Promega as a reporter plasmid pGL3
medaknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvrlaeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisqptvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfvpesfdrdktialimnssgstglpkgvalphrtacvrfshardpifgnqiipdtailsvvpfhhgfgmfttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidkydlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavgkvvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdiaywdedehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagelpaavvvlehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikakkggkskl
Firefly Luciferase(2-416)
Firefly Luciferase( 398-550)
N-FLUC protein daknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvrlaeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisqptvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfvpesfdrdktialimnssgstglpkgvalphrtacvrfshardpifgnqiipdtailsvvpfhhgfgmfttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidkydlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavgkvvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdg
Nucleotide gatgcgaaaaacattaaaaaaggcccggcgccgttttatccgctggaagatggcaccgcgggcgaacagctgcataaagcgatgaaacgctatgcgctggtgccgggcaccattgcgtttaccgatgcgcatattgaagtgaacattacctatgcggaatattttgaaatgagcgtgcgcctggcggaagcgatgaaacgctatggcctgaacaccaaccatcgcattgtggtgtgcagcgaaaacagcctgcagttttttatgccggtgctgggcgcgctgtttattggcgtggcggtggcgccggcgaacgatatttataacgaacgcgaactgctgaacagcatgaacattagccagccgaccgtggtgtttgtgagcaaaaaaggcctgcagaaaattctgaacgtgcagaaaaaactgccgattattcagaaaattattattatggatagcaaaaccgattatcagggctttcagagcatgtatacctttgtgaccagccatctgccgccgggctttaacgaatatgattttgtgccggaaagctttgatcgcgataaaaccattgcgctgattatgaacagcagcggcagcaccggcctgccgaaaggcgtggcgctgccgcatcgcaccgcgtgcgtgcgctttagccatgcgcgcgatccgatttttggcaaccagattattccggataccgcgattctgagcgtggtgccgtttcatcatggctttggcatgtttaccaccctgggctatctgatttgcggctttcgcgtggtgctgatgtatcgctttgaagaagaactgtttctgcgcagcctgcaggattataaaattcagagcgcgctgctggtgccgaccctgtttagcttttttgcgaaaagcaccctgattgataaatatgatctgagcaacctgcatgaaattgcgagcggcggcgcgccgctgagcaaagaagtgggcgaagcggtggcgaaacgctttcatctgccgggcattcgccagggctatggcctgaccgaaaccaccagcgcgattctgattaccccggaaggcgatgataaaccgggcgcggtgggcaaagtggtgccgttttttgaagcgaaagtggtggatctggataccggcaaaaccctgggcgtgaaccagcgcggcgaactgtgcgtgcgcggcccgatgattatgagcggctatgtgaacaacccggaagcgaccaacgcgctgattgataaagatggc
C-FLUC Protein msgyvnnpeatnalidkdgwlhsgdiaywdedehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagelpaavvvlehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikakkggkskl
Nucleotide atgagcggctatgtgaacaacccggaagcgaccaacgcgctgattgataaagatggctggctgcatagcggcgatattgcgtattgggatgaagatgaacatttttttattgtggatcgcctgaaaagcctgattaaatataaaggctatcaggtggcgccggcggaactggaaagcattctgctgcagcatccgaacatttttgatgcgggcgtggcgggcctgccggatgatgatgcgggcgaactgccggcggcggtggtggtgctggaacatggcaaaaccatgaccgaaaaagaaattgtggattatgtggcgagccaggtgaccaccgcgaaaaaactgcgcggcggcgtggtgtttgtggatgaagtgccgaaaggcctgaccggcaaactggatgcgcgcaaaattcgcgaaattctgattaaagcgaaaaaaggcggcaaaagcaaactg
Superfolder split GFP
NOTE readily self assembles as does split Beta-galactosidase
'One fragment of the split GFP contains the first 214 residues of the exceptionally stable, fast-folding ‘‘superfolder’’ GFP protein (Pedelacq et al., 2006), further evolved to be stable as a protein fragment. This fragment includes ten of the eleven strands of the beta-barrel structure of GFP and will be called spGFP1-10. The second split-GFP fragment consists of just 16 residues, 215– 230, which make up the 11th strand of the GFP b-barrel. This second fragment, spGFP11, acts as a small protein tag that can be inserted into many different proteins without affecting their solubility' ref
Amino acid and sequence of the GFP 11 cassette:
SSLKRRKIPMGSSHHHHHHSSGLVPRGSHM*(frame shift +1)
- LIGSDGGSGGGSTSRDHMVLHEYVNAAGIT*GT*LEHHHHHH*DPAANKARKEAELAAATAEQ*LA*PLEA
DNA sequence of the GFP 11 cassette 0421007 TAGAGATACTGAGCACATCAGCAGGACGCACTGACCGAGTTCATTAAAGAGGAGAAAGATACCATGGGCAGCAGCCATCATCATCATCATCACAGCAGCGGCCTGGTGCCGCGCGGCAGCCATATGTAATTAATTAATTGGATCCGATGGAGGGTCTGGTGGCGGATCAACAAGTCGTGACCACATGGTCCTTCATGAGTACGTAAATGCTGCTGGGATTACATAAGGTACCTAACTCGAGCACCACCACCACCACCACTGAGATCCGGCTGCTAACAAAGCCCGAAAGGAAGCTGAGTTGGCTGCTGCCACCGCTGAGCAATAACTAGCATAACCTCTAGAGGCCTC 02129811
Amino acid sequence of the GFP 1-10 cassette DRDLDPAKLIRLTIHMGGTSMSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATIGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGKYKTRAVVKFEGDTLVNRIELKGTDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFTVRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQTVLSKDPNEK*GTLEHHHHHH*DPAANKARKEAELAAATAEQ*LA*PLEA
DNA sequence of the GFP 1-10 cassette
01079936
AGGATCGAGATCTCGATCCCGCGAAATTAATACGACTCACTATACATATGGGTGGCACTAGTATGAGCAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATGGGCACAAATTTTCTGTCAGAGGAGAGGGTGAAGGTGATGCTACAATCGGAAAACTCACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACACTTGTCACTACTCTGACCTATGGTGTTCAATGCTTTTCCCGTTATCCGGATCACATGAAAAGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGAAATACAAGACGCGTGCTGTAGTCAAGTTTGAAGGTGATACCCTTGTTAATCGTATCGAGTTAAAGGGTACTGATTTTAAAGAAGATGGAAACATTCTCGGACACAAACTCGAGTACAACTTTAACTCACACAATGTATACATCACGGCAGACAAACAAAAGAATGGAATCAAAGCTAACTTCACAGTTCGCCACAACGTTGAAGATGGTTCCGTTCAACTAGCAGACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCATTACCTGTCGACACAAACTGTCCTTTCGAAAGATCCCAACGAAAAGTAAGGTACCCTCGAGCACCACCACCACCACCACTGAGATCCGGCTGCTAACAAAGCCCGAAAGGAAGCTGAGTTGGCTGCTGCCACCGCTGAGCAATAACTAGCATAACCTCTAGAGGCCTC
02129811
Re-confirmed sequence for S219D TEV construct
Protein: GRSLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASnftntnnyftSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMDKPEEPFQPVKEATQLMN
Nucleotide: ggccgcagcctgtttaaaggcccgcgcgattataacccgattagcagcaccatttgccatctgaccaacgaaagcgatggccataccaccagcctgtatggcattggctttggcccgtttattattaccaacaaacatctgtttcgccgcaacaacggcaccctgctggtgcagagcctgcatggcgtgtttaaagtgaaaaacaccaccaccctgcagcagcatctgattgatggccgcgatatgattattattcgcatgccgaaagattttccgccgtttccgcagaaactgaaatttcgcgaaccgcagcgcgaagaacgcatttgcctggtgaccaccaactttcagaccaaaagcatgagcagcatggtgagcgataccagctgcacctttccgagcagcgatggcattttttggaaacattggattcagaccaaagatggccagtgcggcagcccgctggtgagcacccgcgatggctttattgtgggcattcatagcgcgagcaactttaccaacaccaacaactattttaccagcgtgccgaaaaactttatggaactgctgaccaaccaggaagcgcagcagtgggtgagcggctggcgcctgaacgcggatagcgtgctgtggggcggccataaagtgtttatggataaaccggaagaaccgtttcagccggtgaaagaagcgacccagctgatgaac
C23O
Catechol 2,3-dioxygenase (also known as C23O or MPC) catalyses the conversion of a colourless substrate (catechol or substituted catechols) into a bright yellow product (2-hydroxymuconic semialdehyde) within seconds of substrate addition.
C23O is a homotetramer and its crystal structure has been solved. See Kita et al or use the accession code 1mpy.
C23O has also been expressed successfully in B. subtilis by Zukowski et al.
We would make a fusion protein by adding, for example, GST to either the C- or N- terminus. This would hopefully prevent oligomerisation until the TEV protease is activated. TEV would specifically cleave the linker between GST and C23O, resulting in C23O monomers that are capable of oligomerising. Homotetramers would then be active and could catalyse the chromogenic reaction.
The N-terminus could be favoured because it seems to be more accessible to the protease as it is on the surface of the monomer. However, it is further away from the oligomerisation interfaces and so might not actually prevent oligomerisation.
The C-terminus, on the other hand, is less accessible, but fusing GST there could prevent entry of the substrate into the funnel that runs through the enzyme. It is also closer to the oligomerisation domain and so fusing GST here is more likely to prevent oligomerisation.
However, when we looked at C23O in Pymol, we noticed that the N-termini were probably closer to the oligomerisation interfaces (see below). Also, we were also worried that we might still get dimerisation if we used the N-terminus for our fusion protein. However, Kita et al show that the projecting loop is needed for dimerisation, and this is very near to the N-terminus.
The C23O gene is already part of a BioBrick (Part:BBa_K118021).
James- some suggested papers:
- Kerppola TK. Complementary methods for studies of protein interactions in living cells. Nat Methods. 2006 Dec;3(12):969-71. DOI:10.1038/nmeth1206-969 |
- Wehr MC, Laage R, Bolz U, Fischer TM, Grünewald S, Scheek S, Bach A, Nave KA, and Rossner MJ. Monitoring regulated protein-protein interactions using split TEV. Nat Methods. 2006 Dec;3(12):985-93. DOI:10.1038/nmeth967 |
GFP as output
- In vivo and in vitro protein solubility assays using split GFP
- Monitoring of conformational change in maltose binding protein using split green fluorescent protein
- Protein Splicing-Based Reconstitution of Split Green Fluorescent Protein for Monitoring Protein−Protein Interactions in Bacteria: Improved Sensitivity and Reduced Screening Time
- A Fluorescent Indicator for Detecting Protein−Protein Interactions in Vivo Based on Protein Splicing
Possible Outputs and their pros and cons
Output | Substrate | Pros | Cons |
---|---|---|---|
Split β-lactamase |
|
|
|
Split Luciferase | Luciferin |
|
|
Split TEV |
|
|
|
Split TEV |
|
|
|
Split TEV |
|
|
|