IGEM:MIT/2007/Ideas3

From OpenWetWare

(Difference between revisions)
Jump to: navigation, search
(OmpX)
(OmpX)
Line 26: Line 26:
[[http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=559693 |OmpX sequence]]
[[http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=559693 |OmpX sequence]]
 +
 +
===Sequence===
 +
#Native SS
 +
<pre>
 +
MKKIACLSALAAVLAFTAGTSVA
 +
</pre>
 +
#Embedded SfiI restriction site
 +
<pre>
 +
GQSGQ
 +
</pre>
 +
#Passenger Peptide
 +
<pre>
 +
XXXXXXXXXXXXXX
 +
</pre>
 +
#Sequence
 +
<pre>
 +
GGQSGQ
 +
</pre>
 +
#S54-F148
 +
<pre>
 +
SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
 +
</pre>
 +
Join native C and N
 +
GGSG
 +
 +
A1-S53
 +
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS
==Papers!==
==Papers!==

Revision as of 15:29, 18 June 2007

Contents

Inbox

  • Put Links and Papers you find for another category here
  • Put your initials next to a link if you're in the process of analyzing it

Metal Pumps and Metal Specific Promoters

Mussel Protein

Expressing proteins on E coli cell membranes

Water Purification Methods

Metal Pumps and Metal Specific Promoters

Mussel Protein

Water Purification Methods

OmpX

[J., Welch, R., Erickson, J.W., and Gross, C.A. 1995. Identification and characterization of an outer membrane protein, OmpX, in Escherichia coli that is homologous to a family of outer membrane proteins including Ail of Yersinia enterocolitica. J. Bacteriol. 177: 799–804.Acad. Sci. 98: 3750–3755. Wittrup, K.D. 2001. Protein engineering by cell-surface display. Curr. Opin. Biotechnol. 12: 395–399.]

[|OmpX sequence]

Sequence

  1. Native SS
MKKIACLSALAAVLAFTAGTSVA
  1. Embedded SfiI restriction site
GQSGQ
  1. Passenger Peptide
XXXXXXXXXXXXXX
  1. Sequence
GGQSGQ
  1. S54-F148
SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF

Join native C and N GGSG

A1-S53 ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS

Papers!

  1. Samuelson P, Wernérus H, Svedberg M, and Ståhl S. . pmid:10698802. PubMed HubMed [Samuelson00]
  2. Kotrba P, Dolecková L, de Lorenzo V, and Ruml T. . pmid:10049868. PubMed HubMed [Kotrba99]
All Medline abstracts: PubMed HubMed
Personal tools