IGEM:MIT/2007/Ideas3

From OpenWetWare

(Difference between revisions)
Jump to: navigation, search
(OmpX)
(Sequence)
Line 28: Line 28:
===Sequence===
===Sequence===
-
#Native SS
+
#Native SS <pre> MKKIACLSALAAVLAFTAGTSVA </pre>
-
<pre>
+
#Embedded SfiI restriction site <pre> GQSGQ </pre>
-
MKKIACLSALAAVLAFTAGTSVA
+
#Passenger Peptide <pre> XXXXXXXXXXXXXX </pre>
-
</pre>
+
#Sequence <pre> GGQSGQ </pre>
-
#Embedded SfiI restriction site
+
#S54-F148 <pre> SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF </pre>
-
<pre>
+
#Join native C and N <pre> GGSG </pre>
-
GQSGQ
+
#A1-S53 <pre> ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS </pre>
-
</pre>
+
-
#Passenger Peptide
+
-
<pre>
+
-
XXXXXXXXXXXXXX
+
-
</pre>
+
-
#Sequence
+
-
<pre>
+
-
GGQSGQ
+
-
</pre>
+
-
#S54-F148
+
-
<pre>
+
-
SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
+
-
</pre>
+
-
Join native C and N
+
-
GGSG
+
-
 
+
-
A1-S53
+
-
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS
+
==Papers!==
==Papers!==

Revision as of 15:32, 18 June 2007

Contents

Inbox

  • Put Links and Papers you find for another category here
  • Put your initials next to a link if you're in the process of analyzing it

Metal Pumps and Metal Specific Promoters

Mussel Protein

Expressing proteins on E coli cell membranes

Water Purification Methods

Metal Pumps and Metal Specific Promoters

Mussel Protein

Water Purification Methods

OmpX

[J., Welch, R., Erickson, J.W., and Gross, C.A. 1995. Identification and characterization of an outer membrane protein, OmpX, in Escherichia coli that is homologous to a family of outer membrane proteins including Ail of Yersinia enterocolitica. J. Bacteriol. 177: 799–804.Acad. Sci. 98: 3750–3755. Wittrup, K.D. 2001. Protein engineering by cell-surface display. Curr. Opin. Biotechnol. 12: 395–399.]

[|OmpX sequence]

Sequence

  1. Native SS
     MKKIACLSALAAVLAFTAGTSVA 
  2. Embedded SfiI restriction site
     GQSGQ 
  3. Passenger Peptide
     XXXXXXXXXXXXXX 
  4. Sequence
     GGQSGQ  
  5. S54-F148
     SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF 
  6. Join native C and N
     GGSG 
  7. A1-S53
     ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS 

Papers!

  1. Samuelson P, Wernérus H, Svedberg M, and Ståhl S. . pmid:10698802. PubMed HubMed [Samuelson00]
  2. Kotrba P, Dolecková L, de Lorenzo V, and Ruml T. . pmid:10049868. PubMed HubMed [Kotrba99]
All Medline abstracts: PubMed HubMed
Personal tools