IGEM:MIT/2007/Ideas3: Difference between revisions
From OpenWetWare
Jump to navigationJump to search
(→OmpX) |
(→OmpX) |
||
Line 30: | Line 30: | ||
==OmpX== | ==OmpX== | ||
<biblio> | |||
# Mecsas95 pmid=7836315 | |||
</biblio> | |||
[[http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=559693 OmpX sequence]] | [[http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=559693 OmpX sequence]] |
Revision as of 07:26, 19 June 2007
Inbox
- Put Links and Papers you find for another category here
- Put your initials next to a link if you're in the process of analyzing it
Metal Pumps and Metal Specific Promoters
Mussel Protein
Expressing proteins on E coli cell membranes
Water Purification Methods
Metal Pumps and Metal Specific Promoters
Mussel Protein
Mgfp-5 Amino Acid Sequence
1 sseeykggyy pgntyhyhsg gsyhgsgyhg gykgkyygka kkyyykykns gkykylkkar 61 kyhrkgykky ygggss
/lue
Water Purification Methods
OmpX
- Mecsas J, Welch R, Erickson JW, and Gross CA. Identification and characterization of an outer membrane protein, OmpX, in Escherichia coli that is homologous to a family of outer membrane proteins including Ail of Yersinia enterocolitica. J Bacteriol. 1995 Feb;177(3):799-804. DOI:10.1128/jb.177.3.799-804.1995 |
Sequence for CPX
- Total length is 558 bp + length of passenger peptide
- Native SS - 69 bp
MKKIACLSALAAVLAFTAGTSVA
- Embedded SfiI restriction site - 15 bp
GQSGQ
- Passenger Peptide
XXXXXXXXXXXXXX
- Sequence - 18 bp
GGQSGQ
- S54-F148 - 285 bp
SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
- Join native C and N - 12 bp
GGSG
- A1-S53 - 159 bp
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS
Papers!
- Samuelson P, Wernérus H, Svedberg M, and Ståhl S. Staphylococcal surface display of metal-binding polyhistidyl peptides. Appl Environ Microbiol. 2000 Mar;66(3):1243-8. DOI:10.1128/AEM.66.3.1243-1248.2000 |
- Kotrba P, Dolecková L, de Lorenzo V, and Ruml T. Enhanced bioaccumulation of heavy metal ions by bacterial cells due to surface display of short metal binding peptides. Appl Environ Microbiol. 1999 Mar;65(3):1092-8. DOI:10.1128/AEM.65.3.1092-1098.1999 |