IGEM:MIT/2007/Ideas3

From OpenWetWare

(Difference between revisions)
Jump to: navigation, search
(OmpX)
(Mussel Protein)
Line 17: Line 17:
==Mussel Protein==
==Mussel Protein==
 +
<biblio>
 +
# Hwang04 pmid=15184131
 +
# Hwang05 pmid=15932281
 +
# Hwang07 pmid=17507090
 +
# Hwang07a pmid=16979252
 +
# Lee06 pmid=16920796
 +
# Lin07 pmid=17360430
 +
# Wang07 pmid=17475323
 +
# Rice07 pmid=16600968
 +
# Bessette04 pmid=15531628
 +
# Etz01 pmid=11698382
 +
# Hall07 pmid=17469847
 +
# Samuelson02 pmid=12039531
 +
# Wernerus04 pmid=15035661
 +
# Gebhart96 pmid=9048419 
 +
# Kenan06 pmid=16873017
 +
# Adey95 pmid=7737512
 +
# Menendez05 pmid=15620878
 +
</biblio>
 +
Mgfp-5 Amino Acid Sequence
Mgfp-5 Amino Acid Sequence

Revision as of 11:11, 19 June 2007

Contents

Inbox

  • Put Links and Papers you find for another category here
  • Put your initials next to a link if you're in the process of analyzing it

Metal Pumps and Metal Specific Promoters

Mussel Protein

Expressing proteins on E coli cell membranes

Water Purification Methods

Metal Pumps and Metal Specific Promoters

Mussel Protein

  1. Hwang DS, Yoo HJ, Jun JH, Moon WK, and Cha HJ. . pmid:15184131. PubMed HubMed [Hwang04]
  2. Hwang DS, Gim Y, and Cha HJ. . pmid:15932281. PubMed HubMed [Hwang05]
  3. Hwang DS, Gim Y, Yoo HJ, and Cha HJ. . pmid:17507090. PubMed HubMed [Hwang07]
  4. Hwang DS, Gim Y, Kang DG, Kim YK, and Cha HJ. . pmid:16979252. PubMed HubMed [Hwang07a]
  5. Lee H, Scherer NF, and Messersmith PB. . pmid:16920796. PubMed HubMed [Lee06]
  6. Lin Q, Gourdon D, Sun C, Holten-Andersen N, Anderson TH, Waite JH, and Israelachvili JN. . pmid:17360430. PubMed HubMed [Lin07]
  7. Wang J, Liu C, Lu X, and Yin M. . pmid:17475323. PubMed HubMed [Wang07]
  8. Rice JJ, Schohn A, Bessette PH, Boulware KT, and Daugherty PS. . pmid:16600968. PubMed HubMed [Rice07]
  9. Bessette PH, Rice JJ, and Daugherty PS. . pmid:15531628. PubMed HubMed [Bessette04]
  10. Etz H, Minh DB, Schellack C, Nagy E, and Meinke A. . pmid:11698382. PubMed HubMed [Etz01]
  11. Hall SS, Mitragotri S, and Daugherty PS. . pmid:17469847. PubMed HubMed [Hall07]
  12. Samuelson P, Gunneriusson E, Nygren PA, and Ståhl S. . pmid:12039531. PubMed HubMed [Samuelson02]
  13. Wernérus H and Ståhl S. . pmid:15035661. PubMed HubMed [Wernerus04]
  14. Gebhardt K, Lauvrak V, Babaie E, Eijsink V, and Lindqvist BH. . pmid:9048419. PubMed HubMed [Gebhart96]
  15. Kenan DJ, Walsh EB, Meyers SR, O'Toole GA, Carruthers EG, Lee WK, Zauscher S, Prata CA, and Grinstaff MW. . pmid:16873017. PubMed HubMed [Kenan06]
  16. Adey NB, Mataragnon AH, Rider JE, Carter JM, and Kay BK. . pmid:7737512. PubMed HubMed [Adey95]
  17. Menendez A and Scott JK. . pmid:15620878. PubMed HubMed [Menendez05]
All Medline abstracts: PubMed HubMed


Mgfp-5 Amino Acid Sequence

 1 sseeykggyy pgntyhyhsg gsyhgsgyhg gykgkyygka kkyyykykns gkykylkkar
61 kyhrkgykky ygggss

/lue

Water Purification Methods

OmpX

  1. Mecsas J, Welch R, Erickson JW, and Gross CA. . pmid:7836315. PubMed HubMed [Mecsas95]

[OmpX sequence]

Sequence for CPX

  • Total length is 558 bp + length of passenger peptide
  1. Native SS - 69 bp
     MKKIACLSALAAVLAFTAGTSVA 
  2. Embedded SfiI restriction site - 15 bp
     GQSGQ 
  3. Passenger Peptide
     XXXXXXXXXXXXXX 
  4. Sequence - 18 bp
     GGQSGQ  
  5. S54-F148 - 285 bp
     SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF 
  6. Join native C and N - 12 bp
     GGSG 
  7. A1-S53 - 159 bp
     ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS 

Papers!

  1. Samuelson P, Wernérus H, Svedberg M, and Ståhl S. . pmid:10698802. PubMed HubMed [Samuelson00]
  2. Kotrba P, Dolecková L, de Lorenzo V, and Ruml T. . pmid:10049868. PubMed HubMed [Kotrba99]
All Medline abstracts: PubMed HubMed
Personal tools