IGEM:MIT/2007/Ideas3

From OpenWetWare

(Difference between revisions)
Jump to: navigation, search
(Mussel Protein)
Line 26: Line 26:
# Wang07 pmid=17475323
# Wang07 pmid=17475323
# Rice07 pmid=16600968
# Rice07 pmid=16600968
 +
# Dane06 pmid=16448666
# Bessette04 pmid=15531628
# Bessette04 pmid=15531628
# Etz01 pmid=11698382
# Etz01 pmid=11698382
Line 35: Line 36:
# Adey95 pmid=7737512
# Adey95 pmid=7737512
# Menendez05 pmid=15620878
# Menendez05 pmid=15620878
 +
# Deming99 pmid=10021411
 +
# Burzio00 pmid=10998254
 +
</biblio>
</biblio>
Line 70: Line 74:
#Samuelson00 pmid=10698802
#Samuelson00 pmid=10698802
#Kotrba99 pmid=10049868
#Kotrba99 pmid=10049868
 +
#pBAD33 pmid=7608087
 +
#koebnik00 pmid=10931321
</biblio>
</biblio>

Revision as of 23:28, 19 June 2007

Contents

Inbox

  • Put Links and Papers you find for another category here
  • Put your initials next to a link if you're in the process of analyzing it

Metal Pumps and Metal Specific Promoters

Mussel Protein

Expressing proteins on E coli cell membranes

Water Purification Methods

Metal Pumps and Metal Specific Promoters

Mussel Protein

Error fetching PMID 15184131:
Error fetching PMID 15932281:
Error fetching PMID 17507090:
Error fetching PMID 16979252:
Error fetching PMID 16920796:
Error fetching PMID 17360430:
Error fetching PMID 17475323:
Error fetching PMID 16600968:
Error fetching PMID 16448666:
Error fetching PMID 15531628:
Error fetching PMID 11698382:
Error fetching PMID 17469847:
Error fetching PMID 12039531:
Error fetching PMID 15035661:
Error fetching PMID 9048419:
Error fetching PMID 16873017:
Error fetching PMID 7737512:
Error fetching PMID 15620878:
Error fetching PMID 10021411:
Error fetching PMID 10998254:
  1. Error fetching PMID 15184131: [Hwang04]
  2. Error fetching PMID 15932281: [Hwang05]
  3. Error fetching PMID 17507090: [Hwang07]
  4. Error fetching PMID 16979252: [Hwang07a]
  5. Error fetching PMID 16920796: [Lee06]
  6. Error fetching PMID 17360430: [Lin07]
  7. Error fetching PMID 17475323: [Wang07]
  8. Error fetching PMID 16600968: [Rice07]
  9. Error fetching PMID 16448666: [Dane06]
  10. Error fetching PMID 15531628: [Bessette04]
  11. Error fetching PMID 11698382: [Etz01]
  12. Error fetching PMID 17469847: [Hall07]
  13. Error fetching PMID 12039531: [Samuelson02]
  14. Error fetching PMID 15035661: [Wernerus04]
  15. Error fetching PMID 9048419: [Gebhart96]
  16. Error fetching PMID 16873017: [Kenan06]
  17. Error fetching PMID 7737512: [Adey95]
  18. Error fetching PMID 15620878: [Menendez05]
  19. Error fetching PMID 10021411: [Deming99]
  20. Error fetching PMID 10998254: [Burzio00]
All Medline abstracts: PubMed HubMed


Mgfp-5 Amino Acid Sequence

 1 sseeykggyy pgntyhyhsg gsyhgsgyhg gykgkyygka kkyyykykns gkykylkkar
61 kyhrkgykky ygggss

/lue

Water Purification Methods

OmpX

Error fetching PMID 7836315:
  1. Error fetching PMID 7836315: [Mecsas95]

[OmpX sequence]

Sequence for CPX

  • Total length is 558 bp + length of passenger peptide
  1. Native SS - 69 bp
     MKKIACLSALAAVLAFTAGTSVA 
  2. Embedded SfiI restriction site - 15 bp
     GQSGQ 
  3. Passenger Peptide
     XXXXXXXXXXXXXX 
  4. Sequence - 18 bp
     GGQSGQ  
  5. S54-F148 - 285 bp
     SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF 
  6. Join native C and N - 12 bp
     GGSG 
  7. A1-S53 - 159 bp
     ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS 

Papers!

Error fetching PMID 10698802:
Error fetching PMID 10049868:
Error fetching PMID 7608087:
Error fetching PMID 10931321:
  1. Error fetching PMID 10698802: [Samuelson00]
  2. Error fetching PMID 10049868: [Kotrba99]
  3. Error fetching PMID 7608087: [pBAD33]
  4. Error fetching PMID 10931321: [koebnik00]
All Medline abstracts: PubMed HubMed
Personal tools