IGEM:MIT/2007/Ideas3
From OpenWetWare
(Difference between revisions)
(→KNOWN PEPTIDES/PROTEINS AND CHARACTERISTICS (please update!)) |
(→KNOWN PEPTIDES/PROTEINS AND CHARACTERISTICS (please update!)) |
||
| Line 66: | Line 66: | ||
+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + | + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + | ||
| - | *Mgfp-5 | + | *Mgfp-5/Mefp-5 |
**Hwang, et al | **Hwang, et al | ||
**75 aa | **75 aa | ||
Revision as of 14:41, 20 June 2007
Contents |
Inbox
- Put Links and Papers you find for another category here
- Put your initials next to a link if you're in the process of analyzing it
Metal Pumps and Metal Specific Promoters
Mussel Protein
Expressing proteins on E coli cell membranes
Water Purification Methods
Metal Pumps and Metal Specific Promoters
Mussel Protein
- Hwang DS, Yoo HJ, Jun JH, Moon WK, and Cha HJ. . pmid:15184131.
- Hwang DS, Gim Y, and Cha HJ. . pmid:15932281.
- Hwang DS, Gim Y, Yoo HJ, and Cha HJ. . pmid:17507090.
- Hwang DS, Gim Y, Kang DG, Kim YK, and Cha HJ. . pmid:16979252.
- Lee H, Scherer NF, and Messersmith PB. . pmid:16920796.
- Lin Q, Gourdon D, Sun C, Holten-Andersen N, Anderson TH, Waite JH, and Israelachvili JN. . pmid:17360430.
- Wang J, Liu C, Lu X, and Yin M. . pmid:17475323.
- Rice JJ, Schohn A, Bessette PH, Boulware KT, and Daugherty PS. . pmid:16600968.
- Dane KY, Chan LA, Rice JJ, and Daugherty PS. . pmid:16448666.
- Bessette PH, Rice JJ, and Daugherty PS. . pmid:15531628.
- Etz H, Minh DB, Schellack C, Nagy E, and Meinke A. . pmid:11698382.
- Hall SS, Mitragotri S, and Daugherty PS. . pmid:17469847.
- Samuelson P, Gunneriusson E, Nygren PA, and Ståhl S. . pmid:12039531.
- Wernérus H and Ståhl S. . pmid:15035661.
- Gebhardt K, Lauvrak V, Babaie E, Eijsink V, and Lindqvist BH. . pmid:9048419.
- Kenan DJ, Walsh EB, Meyers SR, O'Toole GA, Carruthers EG, Lee WK, Zauscher S, Prata CA, and Grinstaff MW. . pmid:16873017.
- Adey NB, Mataragnon AH, Rider JE, Carter JM, and Kay BK. . pmid:7737512.
- Menendez A and Scott JK. . pmid:15620878.
- Deming TJ. . pmid:10021411.
- Burzio LA and Waite JH. . pmid:10998254.
- Burzio LO, Burzio VA, Silva T, Burzio LA, and Pardo J. . pmid:9206011.
- Marumo K and Waite JH. . pmid:3089286.
- Waite JH. . pmid:6298211.
- Waite JH and Qin X. . pmid:11258900.
- Papov VV, Diamond TV, Biemann K, and Waite JH. . pmid:7650037.
Mgfp-5 Amino Acid Sequence
1 sseeykggyy pgntyhyhsg gsyhgsgyhg gykgkyygka kkyyykykns gkykylkkar 61 kyhrkgykky ygggss
/lue
6.20.07
KNOWN PEPTIDES/PROTEINS AND CHARACTERISTICS (please update!)
- Name of peptide/protein
- Paper/Reference
- Length in amino acids
- Obstacles for synthesis?
- Relevant characteristics/Other pertinent information
+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
- Mgfp-5/Mefp-5
- Hwang, et al
- 75 aa
- Obstacles
- "However, these attempts have failed to express functional and economical mussel adhesive proteins for several reasons, including a highly biased amino acid composition (5 amino acid types comprised �89% of the total amino acids), different codon usage preference between mussel and other expression systems (tRNA utilization problem), and small amount of adhesive produced" - Hwang
- Presence of fp-5 has adverse effects on cell growth.
- Positives
- Known sequence
- Very adhesive
- Has a 30% DOPA level, which no other foot protein comes close to
- From M. galloprovincialis; Very adhesive; Low purification yield (but this last fact may not matter for us?)
- Mgfp-1
- Hwang, et al
- … aa
- Mgfp-3
- Hwang, et al
- … aa
- fp-151
- Hwang, et al 2007
- ...aa
- Best adhesiveness; Unknown sequence
- Mefp-1
- Hwang, et al
- 10 aa ?
- Not very adhesive
- Mefp-5
- Mefp-1
Water Purification Methods
OmpX
- Mecsas J, Welch R, Erickson JW, and Gross CA. . pmid:7836315.
Sequence for CPX
- Total length is 558 bp + length of passenger peptide
- Native SS - 69 bp
MKKIACLSALAAVLAFTAGTSVA
- Embedded SfiI restriction site - 15 bp
GQSGQ
- Passenger Peptide
XXXXXXXXXXXXXX
- Sequence - 18 bp
GGQSGQ
- S54-F148 - 285 bp
SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
- Join native C and N - 12 bp
GGSG
- A1-S53 - 159 bp
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS
Papers!
- Samuelson P, Wernérus H, Svedberg M, and Ståhl S. . pmid:10698802.
- Kotrba P, Dolecková L, de Lorenzo V, and Ruml T. . pmid:10049868.
- Pazirandeh M, Wells BM, and Ryan RL. . pmid:9758845.
- Guzman LM, Belin D, Carson MJ, and Beckwith J. . pmid:7608087.
- Koebnik R, Locher KP, and Van Gelder P. . pmid:10931321.


