IGEM:MIT/2007/Ideas3

From OpenWetWare

(Difference between revisions)
Jump to: navigation, search
(→KNOWN PEPTIDES/PROTEINS AND CHARACTERISTICS (please update!))
(→KNOWN PEPTIDES/PROTEINS AND CHARACTERISTICS (please update!))
Line 81: Line 81:
**Hwang, et al 2007
**Hwang, et al 2007
** fp-5 flanked by six decapeptide repeats from fp-1
** fp-5 flanked by six decapeptide repeats from fp-1
-
**Obstacles
+
*** fp-1 sequence: Ala-Lys-Pro-Ser-Tyr-diHyp-Hyp-Thr-DOPA-Lys
-
*** Unknown fp-1 repeat
+
*** diHyp = 3,4 Dihydroxyproline; Hyp= 4 hydroxyproline
**Positives AGK
**Positives AGK
*** Purifies more easily than fp-5
*** Purifies more easily than fp-5

Revision as of 15:15, 20 June 2007

Contents

Inbox

  • Put Links and Papers you find for another category here
  • Put your initials next to a link if you're in the process of analyzing it

Metal Pumps and Metal Specific Promoters

Mussel Protein

Expressing proteins on E coli cell membranes

Water Purification Methods

Metal Pumps and Metal Specific Promoters

Mussel Protein

  1. Hwang DS, Yoo HJ, Jun JH, Moon WK, and Cha HJ. . pmid:15184131. PubMed HubMed [Hwang04]
  2. Hwang DS, Gim Y, and Cha HJ. . pmid:15932281. PubMed HubMed [Hwang05]
  3. Hwang DS, Gim Y, Yoo HJ, and Cha HJ. . pmid:17507090. PubMed HubMed [Hwang07]
  4. Hwang DS, Gim Y, Kang DG, Kim YK, and Cha HJ. . pmid:16979252. PubMed HubMed [Hwang07a]
  5. Lee H, Scherer NF, and Messersmith PB. . pmid:16920796. PubMed HubMed [Lee06]
  6. Lin Q, Gourdon D, Sun C, Holten-Andersen N, Anderson TH, Waite JH, and Israelachvili JN. . pmid:17360430. PubMed HubMed [Lin07]
  7. Wang J, Liu C, Lu X, and Yin M. . pmid:17475323. PubMed HubMed [Wang07]
  8. Rice JJ, Schohn A, Bessette PH, Boulware KT, and Daugherty PS. . pmid:16600968. PubMed HubMed [Rice07]
  9. Dane KY, Chan LA, Rice JJ, and Daugherty PS. . pmid:16448666. PubMed HubMed [Dane06]
  10. Bessette PH, Rice JJ, and Daugherty PS. . pmid:15531628. PubMed HubMed [Bessette04]
  11. Etz H, Minh DB, Schellack C, Nagy E, and Meinke A. . pmid:11698382. PubMed HubMed [Etz01]
  12. Hall SS, Mitragotri S, and Daugherty PS. . pmid:17469847. PubMed HubMed [Hall07]
  13. Samuelson P, Gunneriusson E, Nygren PA, and Ståhl S. . pmid:12039531. PubMed HubMed [Samuelson02]
  14. Wernérus H and Ståhl S. . pmid:15035661. PubMed HubMed [Wernerus04]
  15. Gebhardt K, Lauvrak V, Babaie E, Eijsink V, and Lindqvist BH. . pmid:9048419. PubMed HubMed [Gebhart96]
  16. Kenan DJ, Walsh EB, Meyers SR, O'Toole GA, Carruthers EG, Lee WK, Zauscher S, Prata CA, and Grinstaff MW. . pmid:16873017. PubMed HubMed [Kenan06]
  17. Adey NB, Mataragnon AH, Rider JE, Carter JM, and Kay BK. . pmid:7737512. PubMed HubMed [Adey95]
  18. Menendez A and Scott JK. . pmid:15620878. PubMed HubMed [Menendez05]
  19. Deming TJ. . pmid:10021411. PubMed HubMed [Deming99]
  20. Burzio LA and Waite JH. . pmid:10998254. PubMed HubMed [Burzio00]
  21. Burzio LO, Burzio VA, Silva T, Burzio LA, and Pardo J. . pmid:9206011. PubMed HubMed [Burzio97]
  22. Marumo K and Waite JH. . pmid:3089286. PubMed HubMed [Marumo86]
  23. Waite JH. . pmid:6298211. PubMed HubMed [Waite83]
  24. Waite JH and Qin X. . pmid:11258900. PubMed HubMed [Waite01]
  25. Papov VV, Diamond TV, Biemann K, and Waite JH. . pmid:7650037. PubMed HubMed [Papov95]
All Medline abstracts: PubMed HubMed


Mgfp-5 Amino Acid Sequence 

 1 sseeykggyy pgntyhyhsg gsyhgsgyhg gykgkyygka kkyyykykns gkykylkkar
61 kyhrkgykky ygggss

/lue


6.20.07

KNOWN PEPTIDES/PROTEINS AND CHARACTERISTICS (please update!)

  • Name of peptide/protein
    • Paper/Reference
    • Length in amino acids
    • Obstacles for synthesis?
    • Relevant characteristics/Other pertinent information

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +

  • Mgfp-5/Mefp-5
    • Hwang, et al
    • 75 aa
    • Obstacles AGK
      • "However, these attempts have failed to express functional and economical mussel adhesive proteins for several reasons, including a highly biased amino acid composition (5 amino acid types comprised �89% of the total amino acids), different codon usage preference between mussel and other expression systems (tRNA utilization problem), and small amount of adhesive produced" - Hwang
      • Presence of fp-5 has adverse effects on cell growth.
    • Positives AGK
      • Known sequence
      • Very adhesive
      • Has a 30% DOPA level, which no other foot protein comes close to
      • From M. galloprovincialis; Very adhesive; Low purification yield (but this last fact may not matter for us?)
  • fp-151
    • Hwang, et al 2007
    • fp-5 flanked by six decapeptide repeats from fp-1
      • fp-1 sequence: Ala-Lys-Pro-Ser-Tyr-diHyp-Hyp-Thr-DOPA-Lys
      • diHyp = 3,4 Dihydroxyproline; Hyp= 4 hydroxyproline
    • Positives AGK
      • Purifies more easily than fp-5
      • Not harmful to cells
  • Mgfp-1
    • Hwang, et al
    • … aa
  • Mgfp-3
    • Hwang, et al
    • … aa


  • Mefp-1
    • Hwang, et al
    • 10 aa ?
    • Not very adhesive
  • Mefp-5
  • Mefp-1

Water Purification Methods

OmpX

  1. Mecsas J, Welch R, Erickson JW, and Gross CA. . pmid:7836315. PubMed HubMed [Mecsas95]

[OmpX sequence]

Sequence for CPX

  • Total length is 558 bp + length of passenger peptide
  1. Native SS - 69 bp 
     MKKIACLSALAAVLAFTAGTSVA
  2. Embedded SfiI restriction site - 15 bp
     GQSGQ
  3. Passenger Peptide 
     XXXXXXXXXXXXXX
  4. Sequence - 18 bp
     GGQSGQ
  5. S54-F148 - 285 bp
     SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
  6. Join native C and N - 12 bp
     GGSG
  7. A1-S53 - 159 bp
     ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS

Papers!

  1. Samuelson P, Wernérus H, Svedberg M, and Ståhl S. . pmid:10698802. PubMed HubMed [Samuelson00]
  2. Kotrba P, Dolecková L, de Lorenzo V, and Ruml T. . pmid:10049868. PubMed HubMed [Kotrba99]
  3. Pazirandeh M, Wells BM, and Ryan RL. . pmid:9758845. PubMed HubMed [Biosorbants]
  4. Guzman LM, Belin D, Carson MJ, and Beckwith J. . pmid:7608087. PubMed HubMed [pBAD33]
  5. Koebnik R, Locher KP, and Van Gelder P. . pmid:10931321. PubMed HubMed [koebnik00]
All Medline abstracts: PubMed HubMed
Retrieved from "http://www.openwetware.org/wiki/IGEM:MIT/2007/Ideas3"
Personal tools