IGEM:MIT/2007/Ideas3

From OpenWetWare

(Difference between revisions)
Jump to: navigation, search
(Mussel Protein)
Line 53: Line 53:
/lue
/lue
 +
 +
 +
6.20.07
 +
 +
===KNOWN PEPTIDES/PROTEINS AND CHARACTERISTICS (please update!)===
 +
 +
*Name of peptide/protein
 +
**Paper/Reference
 +
**Length in amino acids
 +
**Obstacles for synthesis?
 +
**Relevant characteristics/Other pertinent information
 +
+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
 +
 +
*Mgfp-5
 +
**Hwang, et al
 +
**75 aa
 +
**Large protein for surface expression with CPX (but what about eCPX?)
 +
**From M. galloprovincialis; Very adhesive; Low purification yield (but this last fact may not matter for us?)
 +
 +
*Mgfp-1
 +
**Hwang, et al
 +
** … aa
 +
**
 +
**
 +
 +
*Mgfp-3
 +
**Hwang, et al
 +
** … aa
 +
**
 +
**
 +
 +
*fp-151
 +
**Hwang, et al 2007
 +
** ...aa
 +
**
 +
**Best adhesiveness; Unknown sequence
 +
 +
*Mefp-1
 +
**Hwang, et al
 +
**10 aa ?
 +
**
 +
**Not very adhesive
 +
 +
*Mefp-5
 +
 +
*Mefp-1
==Water Purification Methods==
==Water Purification Methods==

Revision as of 10:50, 20 June 2007

Contents

Inbox

  • Put Links and Papers you find for another category here
  • Put your initials next to a link if you're in the process of analyzing it

Metal Pumps and Metal Specific Promoters

Mussel Protein

Expressing proteins on E coli cell membranes

Water Purification Methods

Metal Pumps and Metal Specific Promoters

Mussel Protein

Error fetching PMID 15184131:
Error fetching PMID 15932281:
Error fetching PMID 17507090:
Error fetching PMID 16979252:
Error fetching PMID 16920796:
Error fetching PMID 17360430:
Error fetching PMID 17475323:
Error fetching PMID 16600968:
Error fetching PMID 16448666:
Error fetching PMID 15531628:
Error fetching PMID 11698382:
Error fetching PMID 17469847:
Error fetching PMID 12039531:
Error fetching PMID 15035661:
Error fetching PMID 9048419:
Error fetching PMID 16873017:
Error fetching PMID 7737512:
Error fetching PMID 15620878:
Error fetching PMID 10021411:
Error fetching PMID 10998254:
Error fetching PMID 9206011:
Error fetching PMID 3089286:
Error fetching PMID 6298211:
Error fetching PMID 11258900:
Error fetching PMID 7650037:
  1. Error fetching PMID 15184131: [Hwang04]
  2. Error fetching PMID 15932281: [Hwang05]
  3. Error fetching PMID 17507090: [Hwang07]
  4. Error fetching PMID 16979252: [Hwang07a]
  5. Error fetching PMID 16920796: [Lee06]
  6. Error fetching PMID 17360430: [Lin07]
  7. Error fetching PMID 17475323: [Wang07]
  8. Error fetching PMID 16600968: [Rice07]
  9. Error fetching PMID 16448666: [Dane06]
  10. Error fetching PMID 15531628: [Bessette04]
  11. Error fetching PMID 11698382: [Etz01]
  12. Error fetching PMID 17469847: [Hall07]
  13. Error fetching PMID 12039531: [Samuelson02]
  14. Error fetching PMID 15035661: [Wernerus04]
  15. Error fetching PMID 9048419: [Gebhart96]
  16. Error fetching PMID 16873017: [Kenan06]
  17. Error fetching PMID 7737512: [Adey95]
  18. Error fetching PMID 15620878: [Menendez05]
  19. Error fetching PMID 10021411: [Deming99]
  20. Error fetching PMID 10998254: [Burzio00]
  21. Error fetching PMID 9206011: [Burzio97]
  22. Error fetching PMID 3089286: [Marumo86]
  23. Error fetching PMID 6298211: [Waite83]
  24. Error fetching PMID 11258900: [Waite01]
  25. Error fetching PMID 7650037: [Papov95]
All Medline abstracts: PubMed HubMed


Mgfp-5 Amino Acid Sequence

 1 sseeykggyy pgntyhyhsg gsyhgsgyhg gykgkyygka kkyyykykns gkykylkkar
61 kyhrkgykky ygggss

/lue


6.20.07

KNOWN PEPTIDES/PROTEINS AND CHARACTERISTICS (please update!)

  • Name of peptide/protein
    • Paper/Reference
    • Length in amino acids
    • Obstacles for synthesis?
    • Relevant characteristics/Other pertinent information

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +

  • Mgfp-5
    • Hwang, et al
    • 75 aa
    • Large protein for surface expression with CPX (but what about eCPX?)
    • From M. galloprovincialis; Very adhesive; Low purification yield (but this last fact may not matter for us?)
  • Mgfp-1
    • Hwang, et al
    • … aa
  • Mgfp-3
    • Hwang, et al
    • … aa
  • fp-151
    • Hwang, et al 2007
    • ...aa
    • Best adhesiveness; Unknown sequence
  • Mefp-1
    • Hwang, et al
    • 10 aa ?
    • Not very adhesive
  • Mefp-5
  • Mefp-1

Water Purification Methods

OmpX

Error fetching PMID 7836315:
  1. Error fetching PMID 7836315: [Mecsas95]

[OmpX sequence]

Sequence for CPX

  • Total length is 558 bp + length of passenger peptide
  1. Native SS - 69 bp
     MKKIACLSALAAVLAFTAGTSVA 
  2. Embedded SfiI restriction site - 15 bp
     GQSGQ 
  3. Passenger Peptide
     XXXXXXXXXXXXXX 
  4. Sequence - 18 bp
     GGQSGQ  
  5. S54-F148 - 285 bp
     SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF 
  6. Join native C and N - 12 bp
     GGSG 
  7. A1-S53 - 159 bp
     ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS 

Papers!

Error fetching PMID 10698802:
Error fetching PMID 10049868:
Error fetching PMID 9758845:
Error fetching PMID 7608087:
Error fetching PMID 10931321:
  1. Error fetching PMID 10698802: [Samuelson00]
  2. Error fetching PMID 10049868: [Kotrba99]
  3. Error fetching PMID 9758845: [Biosorbants]
  4. Error fetching PMID 7608087: [pBAD33]
  5. Error fetching PMID 10931321: [koebnik00]
All Medline abstracts: PubMed HubMed
Personal tools