IGEM:MIT/2007/Ideas3 - Revision history

Bernice at 04:28, 25 June 2007

Bernice — Mon, 25 Jun 2007 04:28:35 GMT

←Older revision		Revision as of 04:28, 25 June 2007
Line 112:		Line 112:

	==Water Purification Methods==		==Water Purification Methods==
-
-
-	~~==OmpX==~~
-	~~<biblio>~~
-	~~# Mecsas95 pmid=7836315~~
-	~~</biblio>~~
-
-	~~[[http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=559693 OmpX sequence]]~~
-
-	~~===Sequence for CPX===~~
-	*Total length is 558 bp + length of passenger peptide
-	~~#Native SS - 69 bp <pre> MKKIACLSALAAVLAFTAGTSVA </pre>~~
-	~~#Embedded SfiI restriction site - 15 bp<pre> GQSGQ </pre>~~
-	~~#Passenger Peptide <pre> XXXXXXXXXXXXXX </pre>~~
-	~~#Sequence - 18 bp<pre> GGQSGQ </pre>~~
-	~~#S54-F148 - 285 bp<pre> SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF </pre>~~
-	~~#Join native C and N - 12 bp<pre> GGSG </pre>~~
-	~~#A1-S53 - 159 bp<pre> ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS </pre>~~
-
-	~~==Papers!==~~
-	~~<biblio>~~
-	~~#Samuelson00 pmid=10698802~~
-	~~#Kotrba99 pmid=10049868~~
-	~~#Biosorbants pmid=9758845~~
-	~~#pBAD33 pmid=7608087~~
-	~~#koebnik00 pmid=10931321~~
-	~~</biblio>~~
-

	==FhuA==		==FhuA==
Line 151:		Line 123:
	#Coulton86 pmid=3079747		#Coulton86 pmid=3079747
	#Hashemzadeh98 pmid=9822833		#Hashemzadeh98 pmid=9822833
-	~~</biblio>~~
-
-
-	~~==OmpC==~~
-	~~[[http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=protein&id=15832358 OmpC Sequence]]~~
-	~~<biblio>~~
-	~~#Xu99 pmid=10543834~~
	</biblio>		</biblio>

Line 191:		Line 156:
	*sticks to arterial plaque and eats it :)		*sticks to arterial plaque and eats it :)
	*competant bacteria (snarfs up and integrates environmental DNA)		*competant bacteria (snarfs up and integrates environmental DNA)
-
-
-	~~==Heavy Metals==~~
-	~~<biblio>~~
-	~~#Silver05 pmid=16133099~~
-	~~#Bruins00 pmid=10702338~~
-	~~#Hou88 pmid=3056525~~
-	~~#DeMarco04 pmid=15109722~~
-	~~#Paul05 pmid=15734556~~
-	~~#Mergeay03 pmid=12829276~~
-	~~#Weinberg89 pmid=2530602~~
-	~~#Mizuno07 pmid=17475501~~
-	~~#Mehta05 pmid=16294830~~
-	~~#Munoz06 pmid=16307789~~
-	~~#USGS http://water.usgs.gov/wid/html/bioremed.html~~
-	~~#Yang05 pmid=16028496~~
-	~~#Clemes02 pmid=12119168~~
-	~~#Tripathi07 pmid=17306392~~
-	~~#Kamnev00 pmid=11092247~~
-	~~</biblio>~~
-
-
-	~~===Heavy Metals and E. coli===~~
-	~~<biblio>~~
-	~~#Nakajima95 pmid=7793951~~
-	~~#Bontidean98 http://pubs.acs.org/cgi-bin/article.cgi/ancham/1998/70/i19/html/ac9803636.html~~
-	~~#Kotrba99 pmid=10049868~~
-	~~#Mejare01 pmid=11164556~~
-	~~#Lu01 pmid=11710062~~
-	~~#Bae00 pmid=11042548~~
-	~~#Gutnick00 pmid=11092618~~
-	~~#Valls02 pmid=12413663~~
-	~~#Vivas03 pmid=14663492~~
-	~~#Wernerus04 pmid=15035661~~
-	~~</biblio>~~

Toan: /* Heavy Metals and E. coli */

Toan — Sat, 23 Jun 2007 20:59:52 GMT

Heavy Metals and E. coli

←Older revision		Revision as of 20:59, 23 June 2007
Line 218:		Line 218:
	#Bontidean98 http://pubs.acs.org/cgi-bin/article.cgi/ancham/1998/70/i19/html/ac9803636.html		#Bontidean98 http://pubs.acs.org/cgi-bin/article.cgi/ancham/1998/70/i19/html/ac9803636.html
	#Kotrba99 pmid=10049868		#Kotrba99 pmid=10049868
		+	#Mejare01 pmid=11164556
		+	#Lu01 pmid=11710062
		+	#Bae00 pmid=11042548
		+	#Gutnick00 pmid=11092618
		+	#Valls02 pmid=12413663
		+	#Vivas03 pmid=14663492
		+	#Wernerus04 pmid=15035661
	</biblio>		</biblio>

Toan: /* Heavy Metals */

Toan — Sat, 23 Jun 2007 20:45:22 GMT

Heavy Metals

←Older revision		Revision as of 20:45, 23 June 2007
Line 210:		Line 210:
	#Tripathi07 pmid=17306392		#Tripathi07 pmid=17306392
	#Kamnev00 pmid=11092247		#Kamnev00 pmid=11092247
		+	</biblio>
		+
		+
		+	===Heavy Metals and E. coli===
		+	<biblio>
		+	#Nakajima95 pmid=7793951
		+	#Bontidean98 http://pubs.acs.org/cgi-bin/article.cgi/ancham/1998/70/i19/html/ac9803636.html
		+	#Kotrba99 pmid=10049868
	</biblio>		</biblio>

Toan: /* Heavy Metals */

Toan — Sat, 23 Jun 2007 19:45:47 GMT

Heavy Metals

←Older revision		Revision as of 19:45, 23 June 2007
Line 195:		Line 195:
	==Heavy Metals==		==Heavy Metals==
	<biblio>		<biblio>
		+	#Silver05 pmid=16133099
		+	#Bruins00 pmid=10702338
	#Hou88 pmid=3056525		#Hou88 pmid=3056525
	#DeMarco04 pmid=15109722		#DeMarco04 pmid=15109722

Toan: /* Heavy Metals */

Toan — Sat, 23 Jun 2007 19:43:34 GMT

Heavy Metals

←Older revision		Revision as of 19:43, 23 June 2007
Line 203:		Line 203:
	#Mehta05 pmid=16294830		#Mehta05 pmid=16294830
	#Munoz06 pmid=16307789		#Munoz06 pmid=16307789
-	#http://water.usgs.gov/wid/html/bioremed.html	+	#USGS http://water.usgs.gov/wid/html/bioremed.html
	#Yang05 pmid=16028496		#Yang05 pmid=16028496
	#Clemes02 pmid=12119168		#Clemes02 pmid=12119168

Toan: /* New ideas for stickiness from Drew */

Toan — Sat, 23 Jun 2007 19:42:47 GMT

New ideas for stickiness from Drew

←Older revision		Revision as of 19:42, 23 June 2007
Line 191:		Line 191:
	*sticks to arterial plaque and eats it :)		*sticks to arterial plaque and eats it :)
	*competant bacteria (snarfs up and integrates environmental DNA)		*competant bacteria (snarfs up and integrates environmental DNA)
		+
		+
		+	==Heavy Metals==
		+	<biblio>
		+	#Hou88 pmid=3056525
		+	#DeMarco04 pmid=15109722
		+	#Paul05 pmid=15734556
		+	#Mergeay03 pmid=12829276
		+	#Weinberg89 pmid=2530602
		+	#Mizuno07 pmid=17475501
		+	#Mehta05 pmid=16294830
		+	#Munoz06 pmid=16307789
		+	#http://water.usgs.gov/wid/html/bioremed.html
		+	#Yang05 pmid=16028496
		+	#Clemes02 pmid=12119168
		+	#Tripathi07 pmid=17306392
		+	#Kamnev00 pmid=11092247
		+	</biblio>

Awlue: /* Inbox */

Awlue — Fri, 22 Jun 2007 18:56:57 GMT

Inbox

←Older revision		Revision as of 18:56, 22 June 2007
Line 2:		Line 2:
	*Put Links and Papers you find for another category here		*Put Links and Papers you find for another category here
	*Put your initials next to a link if you're in the process of analyzing it		*Put your initials next to a link if you're in the process of analyzing it
		+
		+	===Sticky Proteins===
		+	[http://www.ncbi.nlm.nih.gov/sites/entrez?Db=pubmed&Cmd=ShowDetailView&TermToSearch=16923070&ordinalpos=12&itool=EntrezSystem2.PEntrez.Pubmed.Pubmed_ResultsPanel.Pubmed_RVDocSum Adhesive Properties of Pla]

	===Metal Pumps and Metal Specific Promoters===		===Metal Pumps and Metal Specific Promoters===
-		+	Arsenic binding

	===Mussel Protein===		===Mussel Protein===
Line 10:		Line 13:

	===Water Purification Methods===		===Water Purification Methods===
-
-

	==Metal Pumps and Metal Specific Promoters==		==Metal Pumps and Metal Specific Promoters==

Cookb at 21:34, 21 June 2007

Cookb — Thu, 21 Jun 2007 21:34:48 GMT

←Older revision		Revision as of 21:34, 21 June 2007
Line 158:		Line 158:
	#Xu99 pmid=10543834		#Xu99 pmid=10543834
	</biblio>		</biblio>
		+
		+
		+	==New ideas for stickiness from Drew==
		+	NEW IDEAS:
		+	how do we use conditional stickiness???
		+
		+	*baby machines??? but reason for it? applications?
		+	*yeast surface attachement
		+	*coli background -- non-sticky / non-biofilm forming (indole deficient)
		+	*attacking diseased cells: low oxygen-induced stickiness
		+	**quorum sensing stickiness
		+	**cancer surface markers
		+
		+	*contact: roy curtis (arizona state) -- salmonella as vaccine platform (have you ever wanted salmonella to stick to things)
		+
		+	*stickiness as amplifier of rare phenotypes
		+
		+	*fuel cell (zinc binding)
		+	*magnetotactic
		+
		+	*geobacter (metal pilus -- iron oxide)
		+	*benign (neutral) biocoating for medical grade stuff
		+	*self-assembling bacteria (form 3d structure)
		+	*micron scale assembly (M13 phage factories...)
		+	*spatial polarity? (bacteria -- old poles and new poles!) markers?
		+	**yeast-- bud scar?
		+	**M13 easy
		+
		+	*photogluing: 3D printing (what to use for?)
		+	*checkpoint driven stickiness: (cell cycle synchronization)
		+	*sticks to arterial plaque and eats it :)
		+	*competant bacteria (snarfs up and integrates environmental DNA)

Toan: /* FhuA */

Toan — Thu, 21 Jun 2007 19:13:32 GMT

FhuA

←Older revision		Revision as of 19:13, 21 June 2007
Line 150:		Line 150:
	#Coulton86 pmid=3079747		#Coulton86 pmid=3079747
	#Hashemzadeh98 pmid=9822833		#Hashemzadeh98 pmid=9822833
		+	</biblio>
		+
		+
		+	==OmpC==
		+	[[http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=protein&id=15832358 OmpC Sequence]]
		+	<biblio>
		+	#Xu99 pmid=10543834
	</biblio>		</biblio>

Toan: /* FhuA */

Toan — Thu, 21 Jun 2007 18:47:21 GMT

FhuA

←Older revision		Revision as of 18:47, 21 June 2007
Line 149:		Line 149:
	#Locher98 pmid=9865695		#Locher98 pmid=9865695
	#Coulton86 pmid=3079747		#Coulton86 pmid=3079747
		+	#Hashemzadeh98 pmid=9822833
	</biblio>		</biblio>