Proportal Strains: Difference between revisions
From OpenWetWare
Jump to navigationJump to search
Huiming Ding (talk | contribs) (New page: ==Strain Discussion== ===P-SSP6=== Here is a feature that needed to be added to the genome of the phage P-SSP6. gene complement(33508..33801) /locus_...) |
Huiming Ding (talk | contribs) No edit summary |
||
Line 1: | Line 1: | ||
==Strain Discussion== | ==Strain Discussion== | ||
===MIT-9312=== | |||
Case closed. | |||
===P-SSP6=== | ===P-SSP6=== |
Revision as of 13:24, 23 September 2011
Strain Discussion
MIT-9312
Case closed.
P-SSP6
Here is a feature that needed to be added to the genome of the phage P-SSP6.
gene complement(33508..33801) /locus_tag="PRUG_00040a" /note="Manually added and annotated 09-15-11 by SJL" CDS complement(33508..33801) /locus_tag="PRUG_00040a" /codon_start=1 /transl_table=11 /product="High light inducible protein" /protein_id="CAMERA-phage:PRUG_00040aT0" /translation="EEVSRLAARTVHRHRHANLSFFQMVTTEYGKQNIFATEPQVQVL TMDNENAEIQKWPLGYGRILGGHRCLCHHRTNHSWNLLNLIFFNDNSHTNKTK" /note="Manually added and annotated 09-15-11 by SJL"
The GenBank file of P-SSP6 is attached.
P-SSS3
Here's the Broad FTP for P-SSS3, there's no Genbank file but there is some annotation:
ftp://ftp.broadinstitute.org/BIN/Annotation/broadAnnotation/20100304-dataRelease/P-SSS3/