Proportal Strains: Difference between revisions

From OpenWetWare
Jump to navigationJump to search
(New page: ==Strain Discussion== ===P-SSP6=== Here is a feature that needed to be added to the genome of the phage P-SSP6. gene complement(33508..33801) /locus_...)
 
No edit summary
Line 1: Line 1:
==Strain Discussion==
==Strain Discussion==
===MIT-9312===
Case closed.


===P-SSP6===
===P-SSP6===

Revision as of 13:24, 23 September 2011

Strain Discussion

MIT-9312

Case closed.

P-SSP6

Here is a feature that needed to be added to the genome of the phage P-SSP6.

    gene            complement(33508..33801)
                    /locus_tag="PRUG_00040a"
                    /note="Manually added and annotated 09-15-11 by SJL"
    CDS             complement(33508..33801)
                    /locus_tag="PRUG_00040a"
                    /codon_start=1
                    /transl_table=11
                    /product="High light inducible protein"
                    /protein_id="CAMERA-phage:PRUG_00040aT0"
                    /translation="EEVSRLAARTVHRHRHANLSFFQMVTTEYGKQNIFATEPQVQVL
                    TMDNENAEIQKWPLGYGRILGGHRCLCHHRTNHSWNLLNLIFFNDNSHTNKTK"
                    /note="Manually added and annotated 09-15-11 by SJL"

The GenBank file of P-SSP6 is attached.


P-SSS3

Here's the Broad FTP for P-SSS3, there's no Genbank file but there is some annotation:

ftp://ftp.broadinstitute.org/BIN/Annotation/broadAnnotation/20100304-dataRelease/P-SSS3/