Proportal Strains
From OpenWetWare
Strain Discussion
More new genomes coming
The 96 .gbk files on the Darwin cluster are at:/scratch/kashtan/Annotated/BATS_ALL/
Another batch of genomes
All of the new genomes are on Darwin, at /home/sbiller/newgenomes... in there are subdirectories for the FASTA files of contigs, the RAST annotation genbank files, and the amino acid sequences as determined by RAST.
New genomes to be added,
Strain Name | header 2 | header 3 |
---|---|---|
BATS_4A1C3_ace119 | row 1, cell 2 | row 1, cell 3 |
C12B_closedv3 | row 1, cell 2 | row 1, cell 3 |
GP2 | row 1, cell 2 | row 1, cell 3 |
LG | row 2, cell 2 | row 2, cell 3 |
MIT0601_ace8 | row 2, cell 2 | row 2, cell 3 |
MIT0602_ace7 | row 2, cell 2 | row 2, cell 3 |
MIT0603_ace14 | row 2, cell 2 | row 2, cell 3 |
MIT9107 | row 2, cell 2 | row 2, cell 3 |
MIT9116 | row 2, cell 2 | row 2, cell 3 |
MIT9123 | row 2, cell 2 | row 2, cell 3 |
MIT9201 | row 2, cell 2 | row 2, cell 3 |
MIT9302 | row 2, cell 2 | row 2, cell 3 |
MIT9311 | row 2, cell 2 | row 2, cell 3 |
MIT9314 | row 2, cell 2 | row 2, cell 3 |
MIT9321 | row 2, cell 2 | row 2, cell 3 |
MIT9322 | row 2, cell 2 | row 2, cell 3 |
MIT9401 | row 2, cell 2 | row 2, cell 3 |
SA-C3 | row 2, cell 2 | row 2, cell 3 |
SA-E2 | row 2, cell 2 | row 2, cell 3 |
SA-E6 | row 2, cell 2 | row 2, cell 3 |
SB | row 2, cell 2 | row 2, cell 3 |
SS2 | row 2, cell 2 | row 2, cell 3 |
SS35 | row 2, cell 2 | row 2, cell 3 |
SS51 | row 2, cell 2 | row 2, cell 3 |
SS52 | row 2, cell 2 | row 2, cell 3 |
MIT-9312
Case closed.
P-SSP6
Here is a feature that needed to be added to the genome of the phage P-SSP6.
gene complement(33508..33801) /locus_tag="PRUG_00040a" /note="Manually added and annotated 09-15-11 by SJL" CDS complement(33508..33801) /locus_tag="PRUG_00040a" /codon_start=1 /transl_table=11 /product="High light inducible protein" /protein_id="CAMERA-phage:PRUG_00040aT0" /translation="EEVSRLAARTVHRHRHANLSFFQMVTTEYGKQNIFATEPQVQVL TMDNENAEIQKWPLGYGRILGGHRCLCHHRTNHSWNLLNLIFFNDNSHTNKTK" /note="Manually added and annotated 09-15-11 by SJL"
The GenBank file of P-SSP6 is attached.
P-SSS3
Here's the Broad FTP for P-SSS3, there's no Genbank file but there is some annotation:
ftp://ftp.broadinstitute.org/BIN/Annotation/broadAnnotation/20100304-dataRelease/P-SSS3/