SbpA Protein Sequence

From OpenWetWare

Revision as of 18:21, 3 August 2005 by Norville (Talk | contribs)
(diff) ←Older revision | Current revision (diff) | Newer revision→ (diff)
Jump to: navigation, search

MAKQNKGRKFFAASATAALVASAIVPVASAAQVNDYNKISGYAKEAVQSLVDQGVIQGDTNGNFNPLNTV TRAQAAEIFTKALELEADGDVNFSDVKKGAWYYNSIAAVVANGIFEGVSANEFAPNKSLTRSEAAKVLVD AFGLEGSESLSQFADASQVKGWAKSALETAVANGIFTGSEENGKLNLKPNAAITRQDFAVVFARTLDLAV ETVDASVKAINNTTVEVTFDEEVDNVEALKFKIEGLEVKNAAVKQTNKKVVVLTTEAQTADKEYVVTLDG EEIGKFKGIEAVVPKSIVLKTTNTQGKVGNQVTLTADVGVKAAGIPVTFNVDAPTGSLNKDAVVEVYTNA EGIASYSYTQYAPDADDVTVYPTGAPQLRAFGPVYWGVDNILTIEEVTTGNTLANGVKKTYKVTFKDPKT GAALTNKKLNVSFVENTNVAFNAISKATVTNPSSGLTVTPYQTTTGLQEEIQVTTDSNGQATFVVSGTNT AVTPYVFVDGSSSVLGVSTVTGTNNVTQATTANKKWEATELTATAAQVKFEGAQLNHQITVERDGEEEAA AQYGSKLNGREYKVKVLDKDGKPYANGLVNIGLDEVLDRNLNTNSKAQFANVTDGTALTLNPGTSQQGKI KLNSKGEATVVLYGAKGEVGTPVVWIDQNTSQNNQSGVLEDGEPFFKAPVSNFQYERVMGAEFTVEGKTS NQNVGTDGIANYAFALTNQSGKTLTNLIGKMTYEIRNTSGQPIEVKTPISYRDQNNVSSTLFKIEEYGSI TISADVISTSNAAFTIETAPNGKAATVVVTPSFVTANNFDASADNNLNGVVTDARDFNKHVTAPALTATF GNNKEVGTNYTGTVQYFNKDKKTITFNGKNAVKYAGESGKTYKYFGLGSTPISTADDFITQLQNNAANGS VTVTYKVVDNEVQFYIVSFNNDGAANAVKPEPTAVAPTDGTVAFTNTSFNASANQTITVTDADLNADATV AETTTVKVTSGTVVYTLTATETGVNTGVFTATLTAAQLAVLSDGVITATYEDVKNTTGSSVTRTATATLN TVVGQVNYNAAATTAYSEGNPVAATLTGTGLTQVIGGGALVMKINGTQFTTNVTAINPGTSVADSAAAVA GEINAAAVAAGIITAPATVATVNGTNNIVITSPTAAGSTVEVVSNAATGTGLVVASASATTSAPVKAAWK FTLTTTPAVGEKITVKVGNVEKTYTVALGDTLTTIETALNTAFGTDFDVTLAAGSNVFTVTQDVAAPTTA ELTVTITK

Personal tools