User:Etienne Robillard/Notebook/OPH

From OpenWetWare

(Difference between revisions)
Jump to: navigation, search
m (OPH/DFP)
(32 intermediate revisions not shown.)
Line 3: Line 3:
== Overview ==
== Overview ==
-
Describe succinic acid here.  
+
Notes about OPH (Organo-Phosphate Hydrolase), an enzyme
 +
found in H. sapiens.  
-
== Use ==
+
==Use as voltage-gated, metal-bound electrolyte/proton conductor in cyclic imide additions (Maleimide) ==
 +
 +
* cyclic imide hydrolase (Maleimide) : http://www.kegg.jp/dbget-bin/www_bget?ec:3.5.2.16
 +
* pathway (nicotinamide metabolism): http://www.kegg.jp/kegg-bin/show_pathway?map00760+C01596
 +
* ATP-dependent hydrolase ?
 +
* nicotinamide (NAD-specific) '''neurotoxic''' agent ? 
 +
* keywords: NADPH+, AuNP, ATP (hydrolysis), cyanophosphine
-
* (2R)-2-(methylamino)succinic acid - A dicarboxilic acid usable as titrable buffer agent for orthogonal amino acid protection ?
+
==Dataset==
 +
 
 +
===French Press 6.2.1.3 (123aa)===
 +
NKAGARREGSCGKPIGEDYLIEAFDDDGNMLERGGSGELCISSPTVMKGYLNDTEATEKT
 +
FLDYDGKRWLKTGDLGYVDKDGFIFILQRLKRIIKVSGVPVFPAEIERLVNTLKDVDECC
 +
AVGIEHKLKGKVIKLYVKSSAEP
 +
 
 +
Enzyme name is acyl-coA synthase.
 +
 
 +
Pathway: http://www.kegg.jp/kegg-bin/show_pathway?T30165_04920+179507
 +
 
 +
[http://prosite.expasy.org/PS50001 Matrix]
 +
 
 +
===OPH/DFP===
 +
 
 +
doi: 10.1016/j.abb.2005.08.012, 10.1002/0471264180.or025.02
 +
 
 +
oph: A organo-phosphate (P-O) hydroxyl bound to a ketone or aldehyde. Synthetic intermediate and precursor to organo-phosphate agents known as [http://www.uniprot.org/uniprot/P22303 AChE] inhibitors. Reaction is catalyzed by the Organo-Phosphate Hydrolase enzyme, thus a (Mg)ATP-dependent ligase. See related DOIs above.
 +
 
 +
dfp (Isoflurophate): http://www.drugbank.ca/drugs/DB00677, [http://en.wikipedia.org/wiki/Isoflurophate Wikipedia]
 +
 
 +
EC 3.1.8.2 (DFPase) http://www.genome.jp/dbget-bin/www_bget?ec:3.1.8.2
 +
 
 +
EC 3.1.8.1 (Parathion hydrolase) http://www.uniprot.org/uniprot/P0A433, http://www.drugbank.ca/drugs/DB02138
 +
 
 +
[http://www.hmdb.ca/metabolites/HMDB13035 HMDB]
 +
 
 +
keywords: functionalized diphosphine, chim trills, DFP, Paraoxon
 +
 
 +
Reaction type: <font color=blue>oxidative desulfuration</font color> ([http://biocyc.org/META/NEW-IMAGE?type=COMPOUND&object=PARAOXON BioCyc])
 +
 
 +
Related: [http://www.uniprot.org/uniprot/O15530 3-phosphoinositide-dependent protein kinase 1], [http://www.uniprot.org/uniprot/Q00005 Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform]
 +
 
 +
[http://www.jbc.org/content/283/3/1480.full Regulation of 3-Phosphoinositide-dependent Protein Kinase-1 (PDK1) by Src Involves Tyrosine Phosphorylation of PDK1 and Src Homology 2 Domain Binding]
 +
 
 +
=== BBC x GFP ===
 +
 
 +
* A sort of patented EGFP (chromophore) used as organo-phosphate dye (read dimer?).
 +
* Used for detection of Sarin (GB) gas et al.
 +
* Notes:
 +
# What is a chromophore?
 +
# More info on '''EGFP''' may be found [[GFP|here]].
 +
# US Patent:
== Safety ==
== Safety ==
-
?
+
Unknown. The risks and effects of using succinic acid as calcium channel blocker may need further
 +
study.
==References==
==References==
-
* Wikipedia: http://wikipedia.org/wiki/Succinic_acid
+
# http://www.ccrc.uga.edu/~rcarlson/bcmb3100/Chap27.pdf
 +
# http://www.ebi.ac.uk/interpro/entry/IPR000980
 +
# [http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3076885/ Turning a protein kinase on or off from a single allosteric site via disulfide trapping]
 +
 
 +
==Bibliography==
 +
<biblio>
 +
#imidase pmid=9030755
 +
</biblio>
 +
 
 +
==Did you know?==
 +
 
 +
 
 +
<blockquote>
 +
Love isn't something you find. Love is something that finds you.
 +
- Loretta Young
 +
</blockquote>
[[Category:Material]]
[[Category:Material]]
[[Category:Buffers]]
[[Category:Buffers]]

Revision as of 18:21, 10 October 2013

Contents


Overview

Notes about OPH (Organo-Phosphate Hydrolase), an enzyme found in H. sapiens.

Use as voltage-gated, metal-bound electrolyte/proton conductor in cyclic imide additions (Maleimide)

Dataset

French Press 6.2.1.3 (123aa)

NKAGARREGSCGKPIGEDYLIEAFDDDGNMLERGGSGELCISSPTVMKGYLNDTEATEKT FLDYDGKRWLKTGDLGYVDKDGFIFILQRLKRIIKVSGVPVFPAEIERLVNTLKDVDECC AVGIEHKLKGKVIKLYVKSSAEP

Enzyme name is acyl-coA synthase.

Pathway: http://www.kegg.jp/kegg-bin/show_pathway?T30165_04920+179507

Matrix

OPH/DFP

doi: 10.1016/j.abb.2005.08.012, 10.1002/0471264180.or025.02

oph: A organo-phosphate (P-O) hydroxyl bound to a ketone or aldehyde. Synthetic intermediate and precursor to organo-phosphate agents known as AChE inhibitors. Reaction is catalyzed by the Organo-Phosphate Hydrolase enzyme, thus a (Mg)ATP-dependent ligase. See related DOIs above.

dfp (Isoflurophate): http://www.drugbank.ca/drugs/DB00677, Wikipedia

EC 3.1.8.2 (DFPase) http://www.genome.jp/dbget-bin/www_bget?ec:3.1.8.2

EC 3.1.8.1 (Parathion hydrolase) http://www.uniprot.org/uniprot/P0A433, http://www.drugbank.ca/drugs/DB02138

HMDB

keywords: functionalized diphosphine, chim trills, DFP, Paraoxon

Reaction type: oxidative desulfuration (BioCyc)

Related: 3-phosphoinositide-dependent protein kinase 1, Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform

Regulation of 3-Phosphoinositide-dependent Protein Kinase-1 (PDK1) by Src Involves Tyrosine Phosphorylation of PDK1 and Src Homology 2 Domain Binding

BBC x GFP

  • A sort of patented EGFP (chromophore) used as organo-phosphate dye (read dimer?).
  • Used for detection of Sarin (GB) gas et al.
  • Notes:
  1. What is a chromophore?
  2. More info on EGFP may be found here.
  3. US Patent:

Safety

Unknown. The risks and effects of using succinic acid as calcium channel blocker may need further study.

References

  1. http://www.ccrc.uga.edu/~rcarlson/bcmb3100/Chap27.pdf
  2. http://www.ebi.ac.uk/interpro/entry/IPR000980
  3. Turning a protein kinase on or off from a single allosteric site via disulfide trapping

Bibliography

  1. Ogawa J, Soong CL, Honda M, and Shimizu S. . pmid:9030755. PubMed HubMed [imidase]

Did you know?

Love isn't something you find. Love is something that finds you. - Loretta Young
Personal tools