User:Etienne Robillard/Notebook/DFP

From OpenWetWare

< User:Etienne Robillard | Notebook(Difference between revisions)
Jump to: navigation, search
(French Press 6.2.1.3 (123aa))
Current revision (20:31, 20 July 2015) (view source)
(Replacing page with '{{deleteme}}')
 
(42 intermediate revisions not shown.)
Line 1: Line 1:
-
__TOC__
+
{{deleteme}}
-
 
+
-
== Overview ==
+
-
 
+
-
Describe succinic acid here.
+
-
 
+
-
==Use as voltage-gated pharmacochemical intermediates==
+
-
 
+
-
* (2R)-2-(methylamino)succinic acid (also known as N-methyl-D-asparte receptor) - A dicarboxilic acid usable as titrable buffer agent for orthogonal amino acid protection ?
+
-
 
+
-
==Use as metal-bound electrolyte/proton conductor in cyclic imide additions (Maleimide) ==
+
-
+
-
* cyclic imide hydrolase (Maleimide) : http://www.kegg.jp/dbget-bin/www_bget?ec:3.5.2.16
+
-
* pathway (nicotinamide metabolism): http://www.kegg.jp/kegg-bin/show_pathway?map00760+C01596
+
-
* ATP-dependent hydrolase ?
+
-
* nicotinamide (NAD-specific) '''neurotoxic''' agent ? 
+
-
* keywords: NADPH+, AuNP, ATP (hydrolysis), cyanophosphine
+
-
 
+
-
==Dataset==
+
-
 
+
-
===French Press 6.2.1.3 (123aa)===
+
-
NKAGARREGSCGKPIGEDYLIEAFDDDGNMLERGGSGELCISSPTVMKGYLNDTEATEKT
+
-
FLDYDGKRWLKTGDLGYVDKDGFIFILQRLKRIIKVSGVPVFPAEIERLVNTLKDVDECC
+
-
AVGIEHKLKGKVIKLYVKSSAEP
+
-
 
+
-
Enzyme name is acyl-coA synthase.
+
-
 
+
-
Pathway: http://www.kegg.jp/kegg-bin/show_pathway?T30165_04920+179507
+
-
 
+
-
[http://prosite.expasy.org/PS50001 Matrix]
+
-
 
+
-
== Safety ==
+
-
 
+
-
Unknown. The risks and effects of using succinic acid as calcium channel blocker may need further
+
-
study.
+
-
 
+
-
==References==
+
-
 
+
-
# http://www.ccrc.uga.edu/~rcarlson/bcmb3100/Chap27.pdf
+
-
# http://www.ebi.ac.uk/interpro/entry/IPR000980
+
-
 
+
-
==Bibliography==
+
-
<biblio>
+
-
#imidase pmid=9030755
+
-
</biblio>
+
-
 
+
-
==Did you know?==
+
-
 
+
-
 
+
-
<blockquote>
+
-
Love isn't something you find. Love is something that finds you.
+
-
 
+
-
- Loretta Young
+
-
</blockquote>
+
-
 
+
-
 
+
-
[[Category:Material]]
+
-
[[Category:Buffers]]
+

Current revision

It has been requested that this page be removed with restriction endonucleases.
Other articles for deletion are listed here.
Personal tools