User:Etienne Robillard/Notebook/OPH

From OpenWetWare

(Difference between revisions)
Jump to: navigation, search
(minor modification.)
(style changes)
Line 54: Line 54:
=== BBC x GFP ===
=== BBC x GFP ===
-
A sort of (patented) EGFP (chromophore) used as organo-phosphate dye (read dimer?). Used for
+
* A sort of patented EGFP (chromophore) used as organo-phosphate dye (read dimer?).  
-
detection of Sarin (GB) gas et al.
+
* Used for detection of Sarin (GB) gas et al.
-
 
+
* Notes:
-
Note: What is a chromophore?
+
# What is a chromophore?
-
 
+
# More info on '''EGFP''' may be found [[GFP|here]].
-
US Patent:  
+
# US Patent:  
== Safety ==
== Safety ==

Revision as of 14:35, 4 October 2013

Contents


Overview

Describe succinic acid here.

Use as voltage-gated pharmacochemical intermediates

  • (2R)-2-(methylamino)succinic acid (also known as N-methyl-D-asparte receptor) - A dicarboxilic acid usable as titrable buffer agent for orthogonal amino acid protection ?

Use as metal-bound electrolyte/proton conductor in cyclic imide additions (Maleimide)

Dataset

French Press 6.2.1.3 (123aa)

NKAGARREGSCGKPIGEDYLIEAFDDDGNMLERGGSGELCISSPTVMKGYLNDTEATEKT FLDYDGKRWLKTGDLGYVDKDGFIFILQRLKRIIKVSGVPVFPAEIERLVNTLKDVDECC AVGIEHKLKGKVIKLYVKSSAEP

Enzyme name is acyl-coA synthase.

Pathway: http://www.kegg.jp/kegg-bin/show_pathway?T30165_04920+179507

Matrix

OPH/DFP

doi: 10.1016/j.abb.2005.08.012, 10.1002/0471264180.or025.02

oph: A organo-phosphate (P-O) hydroxyl bound to a ketone or aldehyde. Synthetic intermediate and precursor to organo-phosphate agents known as AChE inhibitors. Reaction is catalyzed by the Organo-Phosphate Hydrolase enzyme, thus a ATP-dependent ligase.

dfp (Isoflurophate): http://www.drugbank.ca/drugs/DB00677, Wikipedia

EC 3.1.8.2 (DFPase) http://www.genome.jp/dbget-bin/www_bget?ec:3.1.8.2

EC 3.1.8.1 (Parathion hydrolase) http://www.uniprot.org/uniprot/P0A433, http://www.drugbank.ca/drugs/DB02138

HMDB

keywords: functionalized diphosphine, chim trills, DFP, Paraoxon

Reaction type: oxidative desulfuration (BioCyc)

Related: 3-phosphoinositide-dependent protein kinase 1, Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform

Regulation of 3-Phosphoinositide-dependent Protein Kinase-1 (PDK1) by Src Involves Tyrosine Phosphorylation of PDK1 and Src Homology 2 Domain Binding

BBC x GFP

  • A sort of patented EGFP (chromophore) used as organo-phosphate dye (read dimer?).
  • Used for detection of Sarin (GB) gas et al.
  • Notes:
  1. What is a chromophore?
  2. More info on EGFP may be found here.
  3. US Patent:

Safety

Unknown. The risks and effects of using succinic acid as calcium channel blocker may need further study.

References

  1. http://www.ccrc.uga.edu/~rcarlson/bcmb3100/Chap27.pdf
  2. http://www.ebi.ac.uk/interpro/entry/IPR000980
  3. Turning a protein kinase on or off from a single allosteric site via disulfide trapping

Bibliography

  1. Ogawa J, Soong CL, Honda M, and Shimizu S. . pmid:9030755. PubMed HubMed [imidase]

Did you know?

Love isn't something you find. Love is something that finds you. - Loretta Young
Personal tools