User:Etienne Robillard/Notebook/DFP

From OpenWetWare

(Difference between revisions)
Jump to: navigation, search
(Use as metal-bound electrolyte/proton conductor in cyclic imide additions (Maleimide))
(minor modifications)
Line 17: Line 17:
* keywords: NADPH+, AuNP, ATP (hydrolysis), cyanophosphine
* keywords: NADPH+, AuNP, ATP (hydrolysis), cyanophosphine
 +
==Dataset==
 +
 +
===French Press 6.2.1.3 (123aa)===
 +
NKAGARREGSCGKPIGEDYLIEAFDDDGNMLERGGSGELCISSPTVMKGYLNDTEATEKT
 +
FLDYDGKRWLKTGDLGYVDKDGFIFILQRLKRIIKVSGVPVFPAEIERLVNTLKDVDECC
 +
AVGIEHKLKGKVIKLYVKSSAEP
 +
 +
Enzyme name is acyl-coA synthase.
 +
 +
Pathway: http://www.kegg.jp/kegg-bin/show_pathway?T30165_04920+179507
== Safety ==
== Safety ==

Revision as of 10:46, 31 August 2013

Contents


Overview

Describe succinic acid here.

Use as voltage-gated pharmacochemical intermediates

  • (2R)-2-(methylamino)succinic acid (also known as N-methyl-D-asparte receptor) - A dicarboxilic acid usable as titrable buffer agent for orthogonal amino acid protection ?

Use as metal-bound electrolyte/proton conductor in cyclic imide additions (Maleimide)

Dataset

French Press 6.2.1.3 (123aa)

NKAGARREGSCGKPIGEDYLIEAFDDDGNMLERGGSGELCISSPTVMKGYLNDTEATEKT FLDYDGKRWLKTGDLGYVDKDGFIFILQRLKRIIKVSGVPVFPAEIERLVNTLKDVDECC AVGIEHKLKGKVIKLYVKSSAEP

Enzyme name is acyl-coA synthase.

Pathway: http://www.kegg.jp/kegg-bin/show_pathway?T30165_04920+179507

Safety

Unknown. The risks and effects of using succinic acid as calcium channel blocker may need further study.

References


Bibliography

Error fetching PMID 9030755:
  1. Error fetching PMID 9030755: [imidase]

Did you know?

Love isn't something you find. Love is something that finds you. - Loretta Young
Personal tools