User:Mohammad H. Dezfulian: Difference between revisions

From OpenWetWare
Jump to navigationJump to search
(40 intermediate revisions by the same user not shown)
Line 2: Line 2:
|-valign="top"
|-valign="top"
|width=450px style="padding: 5px; background-color: #ffffff; border: 2px solid #228B22;" |
|width=450px style="padding: 5px; background-color: #ffffff; border: 2px solid #228B22;" |
<h3><font style="color:#006400;">Fluorescent Proteins </font></h3>
<br/>


==Venus YFP==
== Publications ==


>'''mVenus Protein sequence''' (Venus YFP with monomerizing A206K mutation)
[http://www.ncbi.nlm.nih.gov/pubmed/?term=(dezfulian+m)+and+(Sardari+S)+OR+(Dezfulian+MH) Search Pubmed for an updated list of publications]


MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPT
=== Peer Reviewed ===
LVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTL
1. Sardari, S. and '''Dezfulian, MH.''' (2005) Evaluation of SAR for Amphotericin B Derivatives by Artificial Neural Network. Tropical Journal of Pharmaceutical Research [https://dl.dropboxusercontent.com/u/43366175/14628-13779-1-PB.pdf Link]
VNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLA
DHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK-


>'''mVenus DNA sequence''' (Venus YFP with monomerizing A206K mutation-720bp)
2. Sardari, S. and '''Dezfulian, MH.''' (2007) Cheminformatics in anti-infective agent discovery. Mini Review in Medicinal Chemistry [https://dl.dropboxusercontent.com/u/43366175/medicinal-chemistry2010.pdf Link]


ATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACG
3. '''Dezfulian, MH.''' Soulliere, DM. Dhaliwal, RK. Sareen, M. Crosby, WL. (2012) High level of functional divergence among closely related ASK genes in Arabidopsis thaliana. Plos One, [http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0050984 Link]
GCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGG
CAAGCTGACCCTGAAGCTGATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTC
GTGACCACCCTGGGCTACGGCCTGCAGTGCTTCGCCCGCTACCCCGACCACATGAAGCAGC
ACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAA
GGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAAC
CGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGG
AGTACAACTACAACAGCCACAACGTCTATATCACCGCCGACAAGCAGAAGAACGGCATCAA
GGCCAACTTCAAGATCCGCCACAACATCGAGGACGGCGGCGTGCAGCTCGCCGACCACTAC
CAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCT
ACCAGTCCAAGCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTT
CGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAA


==ECFP==
4.      '''Dezfulian, M.H.''' Jall, E.  Roberto, D.K.A.  Moss, B.M. Khoo, K. Nemhauser, J.L. Crosby W.L.  Oligomerization of SCF TIR1 is essential for Aux/IAA binding and Auxin signaling in Arabidopsis. (Submitted)
>'''Enhanced CFP '''


MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPT
5.      '''Dezfulian, M.H.'''  Foreman, C. Jall, E.  Pal, M.  Dhaliwal, R. K.  Roberto, D.K. Crosby, W.L. Acetolactate synthase regulatory subunits can sense different concentrations of valine and play divergent but overlapping roles throughout the development of Arabidopsis. (Submitted)
LVTTLTWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTL
VNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKANFKIRHNIEDGSVQLA
DHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK-


>'''Enhanced  CFP'''
=== Non Peer Reviewed ===


ATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACG
1. Sardari, S. and Dezfulian, MH. The Eastern Mediterranean Health Genomics and Biotechnology Network Critical for the Region. (2006) Genetic Engineering News [http://www.genengnews.com/keywordsandtools/print/1/11775/ Link]
GCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGG
CAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTC
GTGACCACCCTGACCTGGGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGC
ACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAA
GGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAAC
CGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGG
AGTACAACTACATCAGCCACAACGTCTATATCACCGCCGACAAGCAGAAGAACGGCATCAA
GGCCAACTTCAAGATCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTAC
CAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCA
CCCAGTCCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTT
CGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAA


==mCherry==
== Conference Presentations ==
>'''mCherry'''


MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLP
1. Bioactivity and chemical informatics of modeled microtubule inhibitors: Identification of key features and design of new agents in the treatment of cancer. (2005)  Sardari, S. '''Dezfulian, MH.'''
FAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQD
''TETRAHEDRON SYMPOSIUM 2005 Challenges in Organic Chemistry, Paris''
GEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDA
EVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK-


>'''mCherry'''
2. Synthetic strategies in protecting group selection and compound library design by informatics modeled group chemistry and neural networking. (2005) Sardari, S. Zolfaghari Jooya, H. '''Dezfulian MH.''' Omidi, M.
''TETRAHEDRON SYMPOSIUM 2005 Challenges in Organic Chemistry, Paris''


ATGGTGAGCAAGGGCGAGGAGGATAACATGGCCATCATCAAGGAGTTCATGCGCTTCAAGGT
3. Molecular informatics, QSPR and computer modeling of microtubule inhibitors: Identification of key features and design of new agents in the treatment of tuberculosis. (2005) '''Dezfulian, MH.''' Sardari, S.
GCACATGGAGGGCTCCGTGAACGGCCACGAGTTCGAGATCGAGGGCGAGGGCGAGGGCCGCC
''34th International Scientific Meeting of the Directors of Pasteur Institute, Tehran''
CCTACGAGGGCACCCAGACCGCCAAGCTGAAGGTGACCAAGGGTGGCCCCCTGCCCTTCGCC
 
TGGGACATCCTGTCCCCTCAGTTCATGTACGGCTCCAAGGCCTACGTGAAGCACCCCGCCGA
4. QSPR modeling of Gyrase inhibitors of Trypanosoma: Identification of new agents. (2005) '''Dezfulian, MH.''' Jalili, E. Sardari, S.
CATCCCCGACTACTTGAAGCTGTCCTTCCCCGAGGGCTTCAAGTGGGAGCGCGTGATGAACT
''First National Congress on Molecular Microbiology Karaj''
TCGAGGACGGCGGCGTGGTGACCGTGACCCAGGACTCCTCCCTGCAGGACGGCGAGTTCATC
 
TACAAGGTGAAGCTGCGCGGCACCAACTTCCCCTCCGACGGCCCCGTAATGCAGAAGAAGAC
5. A computer based model for anti Topoisomearse II compounds, a novel approach for evaluation of anti-cancer drugs. (2005) '''Dezfulian, MH.''' Jalili, E. Sardari, S.
CATGGGCTGGGAGGCCTCCTCCGAGCGGATGTACCCCGAGGACGGCGCCCTGAAGGGCGAGA
''First International Congress of Biology & 13th National Congress of Biology, Rasht''
TCAAGCAGAGGCTGAAGCTGAAGGACGGCGGCCACTACGACGCTGAGGTCAAGACCACCTAC
 
AAGGCCAAGAAGCCCGTGCAGCTGCCCGGCGCCTACAACGTCAACATCAAGTTGGACATCAC
6. Artificial Neural Networks in Cheminformatics.* (2005) '''Dezfulian, MH.'''
CTCCCACAACGAGGACTACACCATCGTGGAACAGTACGAACGCGCCGAGGGCCGCCACTCCA
''Research Day, Chamran, University of Ahvaz '' Invited Speaker
CCGGCGGCATGGACGAGCTGTACAAGTAG
 
7. Molecular Modelling of Methionyl-tRNA Synthetase Inhibitors in Staphylococcus aureus. (2005) Jalili, E. Dezfulian MH. Sardari, S.
''1st Student Conference of Biotechnology, Tehran ''
 
8. A screening study of hereditary nonpolyposis colorectal cancer (HNPCC), by Microsatellite marker analysis in Khorasan Province of Iran. (2006) Ahmadi, A.  Galehdari, H. '''Dezfulian, MH.'''
''International Medical Genetic Conference, Kuwait'' 
 
9. A Neural Network based model for evaluation of Anti-malarial Drugs. (2006)  Sardari, S.  Galehdari, H. Jalili, E. Dezfulian, MH.
International Pharmaceutical Sciences Congress, Tehran
 
10. Functional Analysis of SKP1 genes in Arabidopsis thaliana. (2008) '''Dezfulian, MH.''' Crosby, WL.
''19th International Conference on Arabidopsis Research , Montreal'' [https://www.arabidopsis.org/servlets/TairObject?type=publication&id=501728110 Abstract]
 
11. From Protein Complex to Supra-Complex. (2011)  Crosby, WL.  '''Dezfulian, MH.''' Dinatale, C.
''International Conference on Biomedical Ontology (ICBO), Buffalo, NY'' [http://icbo.buffalo.edu/2011/slides/Thursday%20Protein_Panel/protein-complex_crosby_v4_jul2011.pptx PPT]
 
12. E3-Ubiquitin Ligases as a Use-Case Scenario For Developing Quaternary Protein Complex Ontologies (2012) Crosby, WL.  Dezfulian, MH. Dinatale, C. ''Plant and Animal Genome XX Conference, San Diego'' [https://pag.confex.com/pag/xx/webprogram/Paper1868.html Abstract]
 
13. Identification of Ubiquitinated proteins in Arabidopsis thaliana using Protein Microarrays (2012) '''Dezfulian MH,''' Roberto DKA, Popescu SC, Crosby WL
''ICSB-2012 - The 13th International Conference on Systems Biology, Toronto, Canada''
 
14. Ab initio Assembly, Annotation and Analysis of the Phaseolus var. OAC-REX Genome (2012) Dinatale C, Platts A, '''Dezfulian MH''', Perry G, Pauls KP,  Crosby WL
''Phaseomics-The Genome conference, Guanajuato, Mexico'' [http://datos.langebio.cinvestav.mx/~aherrera/phaseomics/Abstract_Book.pdf Abstract]
 
15. Computational Analysis of Domain Interactions in Stability of Protein-protein Interactions (2014) Maleki M., '''Dezfulian MH''', Crosby WL, Rueda L.
''18th Annual International Conference on Research in Computational Molecular Biology, Pittsburgh, Pennsylvania'' [http://cdn.f1000.com/posters/docs/261044063 Poster]
==Academic Honors/Fellowships==
*2012-2013 Queen Elizabeth II Graduate Scholarships in Science and Technology
 
*2012 Conference Travel Award,University of Windsor, Department of Graduate Studies
 
*2011-2012 Graduate Student Society Award University of Windsor, Graduate Student Society                                                                                                                                  
 
*2011-Present Golden Key International Honor Society
 
*2010-2011 International Student Society Award University of Windsor, International Student Society International Student of the Year
*2009-2010 Graduate Excellence Award University of Windsor, Department of Biological Sciences Graduate Student of the Year
 
*2008-2012 Graduate Excellence Scholarship University of Windsor, Department of Graduate Studies
 
*2008 Conference Travel Award University of Windsor, Department of Graduate Studies
*2006-2012 International Graduate Scholarship University of Windsor, Department of Graduate Studies
 
<html>
<!-- Start of StatCounter Code for Wikispaces -->
<script type="text/javascript">
var sc_project=6533187;
var sc_invisible=1;
var sc_security="c74903c0";
</script>
<script type="text/javascript"
src="http://www.statcounter.com/counter/counter.js"></script>
<noscript><div class="statcounter"><a title="web analytics"
href="http://statcounter.com/" target="_blank"><img
class="statcounter"
src="http://c.statcounter.com/6533187/0/c74903c0/1/"
alt="web analytics"></a></div></noscript>
<!-- End of StatCounter Code for Wikispaces -->
</html>

Revision as of 09:45, 3 July 2014

Publications

Search Pubmed for an updated list of publications

Peer Reviewed

1. Sardari, S. and Dezfulian, MH. (2005) Evaluation of SAR for Amphotericin B Derivatives by Artificial Neural Network. Tropical Journal of Pharmaceutical Research Link

2. Sardari, S. and Dezfulian, MH. (2007) Cheminformatics in anti-infective agent discovery. Mini Review in Medicinal Chemistry Link

3. Dezfulian, MH. Soulliere, DM. Dhaliwal, RK. Sareen, M. Crosby, WL. (2012) High level of functional divergence among closely related ASK genes in Arabidopsis thaliana. Plos One, Link

4. Dezfulian, M.H. Jall, E. Roberto, D.K.A. Moss, B.M. Khoo, K. Nemhauser, J.L. Crosby W.L. Oligomerization of SCF TIR1 is essential for Aux/IAA binding and Auxin signaling in Arabidopsis. (Submitted)

5. Dezfulian, M.H. Foreman, C. Jall, E. Pal, M. Dhaliwal, R. K. Roberto, D.K. Crosby, W.L. Acetolactate synthase regulatory subunits can sense different concentrations of valine and play divergent but overlapping roles throughout the development of Arabidopsis. (Submitted)

Non Peer Reviewed

1. Sardari, S. and Dezfulian, MH. The Eastern Mediterranean Health Genomics and Biotechnology Network Critical for the Region. (2006) Genetic Engineering News Link

Conference Presentations

1. Bioactivity and chemical informatics of modeled microtubule inhibitors: Identification of key features and design of new agents in the treatment of cancer. (2005) Sardari, S. Dezfulian, MH. TETRAHEDRON SYMPOSIUM 2005 Challenges in Organic Chemistry, Paris

2. Synthetic strategies in protecting group selection and compound library design by informatics modeled group chemistry and neural networking. (2005) Sardari, S. Zolfaghari Jooya, H. Dezfulian MH. Omidi, M. TETRAHEDRON SYMPOSIUM 2005 Challenges in Organic Chemistry, Paris

3. Molecular informatics, QSPR and computer modeling of microtubule inhibitors: Identification of key features and design of new agents in the treatment of tuberculosis. (2005) Dezfulian, MH. Sardari, S. 34th International Scientific Meeting of the Directors of Pasteur Institute, Tehran

4. QSPR modeling of Gyrase inhibitors of Trypanosoma: Identification of new agents. (2005) Dezfulian, MH. Jalili, E. Sardari, S. First National Congress on Molecular Microbiology Karaj

5. A computer based model for anti Topoisomearse II compounds, a novel approach for evaluation of anti-cancer drugs. (2005) Dezfulian, MH. Jalili, E. Sardari, S. First International Congress of Biology & 13th National Congress of Biology, Rasht

6. Artificial Neural Networks in Cheminformatics.* (2005) Dezfulian, MH. Research Day, Chamran, University of Ahvaz Invited Speaker

7. Molecular Modelling of Methionyl-tRNA Synthetase Inhibitors in Staphylococcus aureus. (2005) Jalili, E. Dezfulian MH. Sardari, S. 1st Student Conference of Biotechnology, Tehran

8. A screening study of hereditary nonpolyposis colorectal cancer (HNPCC), by Microsatellite marker analysis in Khorasan Province of Iran. (2006) Ahmadi, A. Galehdari, H. Dezfulian, MH. International Medical Genetic Conference, Kuwait

9. A Neural Network based model for evaluation of Anti-malarial Drugs. (2006) Sardari, S. Galehdari, H. Jalili, E. Dezfulian, MH. International Pharmaceutical Sciences Congress, Tehran

10. Functional Analysis of SKP1 genes in Arabidopsis thaliana. (2008) Dezfulian, MH. Crosby, WL. 19th International Conference on Arabidopsis Research , Montreal Abstract

11. From Protein Complex to Supra-Complex. (2011) Crosby, WL. Dezfulian, MH. Dinatale, C. International Conference on Biomedical Ontology (ICBO), Buffalo, NY PPT

12. E3-Ubiquitin Ligases as a Use-Case Scenario For Developing Quaternary Protein Complex Ontologies (2012) Crosby, WL. Dezfulian, MH. Dinatale, C. Plant and Animal Genome XX Conference, San Diego Abstract

13. Identification of Ubiquitinated proteins in Arabidopsis thaliana using Protein Microarrays (2012) Dezfulian MH, Roberto DKA, Popescu SC, Crosby WL ICSB-2012 - The 13th International Conference on Systems Biology, Toronto, Canada

14. Ab initio Assembly, Annotation and Analysis of the Phaseolus var. OAC-REX Genome (2012) Dinatale C, Platts A, Dezfulian MH, Perry G, Pauls KP, Crosby WL Phaseomics-The Genome conference, Guanajuato, Mexico Abstract

15. Computational Analysis of Domain Interactions in Stability of Protein-protein Interactions (2014) Maleki M., Dezfulian MH, Crosby WL, Rueda L. 18th Annual International Conference on Research in Computational Molecular Biology, Pittsburgh, Pennsylvania Poster

Academic Honors/Fellowships

  • 2012-2013 Queen Elizabeth II Graduate Scholarships in Science and Technology
  • 2012 Conference Travel Award,University of Windsor, Department of Graduate Studies
  • 2011-2012 Graduate Student Society Award University of Windsor, Graduate Student Society
  • 2011-Present Golden Key International Honor Society
  • 2010-2011 International Student Society Award University of Windsor, International Student Society International Student of the Year
  • 2009-2010 Graduate Excellence Award University of Windsor, Department of Biological Sciences Graduate Student of the Year
  • 2008-2012 Graduate Excellence Scholarship University of Windsor, Department of Graduate Studies
  • 2008 Conference Travel Award University of Windsor, Department of Graduate Studies
  • 2006-2012 International Graduate Scholarship University of Windsor, Department of Graduate Studies

<html> <!-- Start of StatCounter Code for Wikispaces --> <script type="text/javascript"> var sc_project=6533187; var sc_invisible=1; var sc_security="c74903c0"; </script> <script type="text/javascript" src="http://www.statcounter.com/counter/counter.js"></script> <noscript><div class="statcounter"><a title="web analytics" href="http://statcounter.com/" target="_blank"><img class="statcounter" src="http://c.statcounter.com/6533187/0/c74903c0/1/" alt="web analytics"></a></div></noscript> <!-- End of StatCounter Code for Wikispaces --> </html>