User talk:Etienne Robillard/Notebook/NMDA dependent cell adhesion

From OpenWetWare

(Difference between revisions)
Jump to: navigation, search

Etienne Robillard (Talk | contribs)
(The Nagai (p53) connection: optogenetics tour de force or synthetic red heering ?)
Next diff →

Revision as of 21:46, 14 April 2013

The Nagai (p53) connection: optogenetics tour de force or synthetic red heering ?

  • Protein translation sequence (tblastn):

MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD

Personal tools