User talk:Etienne Robillard/Notebook/NMDA dependent cell adhesion

From OpenWetWare

< User talk:Etienne Robillard(Difference between revisions)
Jump to: navigation, search
(The Nagai (p53) connection: optogenetics tour de force or synthetic red heering ?)
Current revision (21:40, 14 May 2013) (view source)
 

Current revision

The Nagai (p53) connection: optogenetics tour de force or synthetic red heering ?

  • Protein translation sequence (tblastn):

MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD

Personal tools