Wikiomics:BLAST tutorial: Difference between revisions
Darek Kedra (talk | contribs) m (file link) |
Darek Kedra (talk | contribs) m (→Mitrion-C for BLAST: delete: company went down) |
||
(20 intermediate revisions by 3 users not shown) | |||
Line 1: | Line 1: | ||
[http://www.ncbi.nlm.nih.gov/BLAST Blast] most popular DNA/protein sequence search algorithm tool. See also [[Wikipedia:BLAST]]. | [http://www.ncbi.nlm.nih.gov/BLAST Blast] most popular DNA/protein sequence search algorithm tool. See also [[Wikipedia:BLAST]]. | ||
This tutorial covers previous version of blast (blastall). The newest BLAST+ tools use NCBI C++ Toolkit and offer new functionality not covered here. | |||
For detailed help on command line blastall switches type: | |||
<pre> | |||
blastall --help | |||
</pre> | |||
Download blast searches results from [http://openwetware.org/wiki/Image:Blast_course_080208.zip here] | Download blast searches results from [http://openwetware.org/wiki/Image:Blast_course_080208.zip here] | ||
Line 167: | Line 172: | ||
blastall -p blastp -d ecoli_aa -i my_nn_fasta_file.fa -o my_nn_fasta_file_vs_ecolidb.blastp_out | blastall -p blastp -d ecoli_aa -i my_nn_fasta_file.fa -o my_nn_fasta_file_vs_ecolidb.blastp_out | ||
</pre> | </pre> | ||
=Non-command line BLAST= | |||
BLAST can be setup to be queried using an internet browser instead of a command line, using NCBI's [[wwwblast]] software. The command line must be used during the setup of wwwblast, but not when running the actual BLAST queries. | |||
=Advanced topics= | =Advanced topics= | ||
Line 173: | Line 181: | ||
By default '''blastp''' uses BLOSUM62 ( a matrix constructed from local alignment of proteins with similarity 62% and better). One can use '''BLOSUM45''' for more divergent sequences and '''BLOSUM80''' for closer related ones. | By default '''blastp''' uses BLOSUM62 ( a matrix constructed from local alignment of proteins with similarity 62% and better). One can use '''BLOSUM45''' for more divergent sequences and '''BLOSUM80''' for closer related ones. | ||
For very short protein queries (15 aa and less) use PAM30 [1]. | |||
See also: [http://www.biohealthbase.org/gsearch/bhbHelp/blast_matrix.htm] | |||
1. Jonathan Pevsner, Bioinformatics and Functional Genomics (John Wiley and Sons, 2009), p110. | |||
==Word size== | ==Word size== | ||
Line 192: | Line 206: | ||
** CAVEAT: transmembrane and coiled-coil regions are not masked by NCBI BLAST tools and therefore will give a spurious, non-homologous hits. You have to detect them and mask them yourself. | ** CAVEAT: transmembrane and coiled-coil regions are not masked by NCBI BLAST tools and therefore will give a spurious, non-homologous hits. You have to detect them and mask them yourself. | ||
* custom | * custom filtering (lower case masking) | ||
By providing query sequence i.e. genomic sequence with '''EXONS''' as capitals and '''introns''' in small letters we can search exonic sequences only. | By providing query sequence i.e. genomic sequence with '''EXONS''' as capitals and '''introns''' in small letters we can search exonic sequences only. | ||
==Filtering blast output using Entrez query== | |||
One can be interested only in blast hits from i.e. specific organism. On a command line: | |||
<pre> | |||
blastall -u "[Arabidopsis thaliana[organism]" -p blastp -d nr -i my_protein_input.fas -o my_protein_input_vs_nr_Athaliana.blastout.txt | |||
</pre> | |||
This can also be written as: | |||
<pre> | |||
blastall -u "txid3702[ORGN]" -p blastp -d nr -i my_protein_input.fas -o my_protein_input_vs_nr_Athaliana.blastout.txt | |||
</pre> | |||
=BLAST implementations= | =BLAST implementations= | ||
Line 199: | Line 224: | ||
* Cha, I.E., and E.C. Rouchka. “Comparison of Current BLAST Software on Nucleotide Sequences.” In Parallel and Distributed Processing Symposium, 2005. Proceedings. 19th IEEE International, 8 pp., 2005. | * Cha, I.E., and E.C. Rouchka. “Comparison of Current BLAST Software on Nucleotide Sequences.” In Parallel and Distributed Processing Symposium, 2005. Proceedings. 19th IEEE International, 8 pp., 2005. | ||
==WU-BLAST== | Most popular are WU-BLAST and a distant second MPI-BLAST. Things to watch: ScalaBLAST, Grid-based implementation on one side and FPGA/CUDA hardware. | ||
==WU-BLAST / AB-BLAST== | |||
Often faster implementation of BLAST algorithm from Washington University. | Often faster implementation of BLAST algorithm from Washington University. | ||
* http://blast.wustl.edu/ | * http://blast.wustl.edu/ | ||
Program was licensed to [http://www.advbiocomp.com/blast.html Advanced Biocomputing] and becoming AB-BLAST. Previous licenses are still valid, but WU-BLAST versions except an obsolete 2.0a19 from 1998 are unavailable. Latest AB-BLAST version is 2009-10-30. Licensing is [http://blast.advbiocomp.com/licensing/ here] (1k$ /year/lab, free for personal use on your own computer). | |||
==MPI-BLAST== | ==MPI-BLAST== | ||
BLAST implementation suitable for clusters | BLAST implementation suitable for clusters, under active development. | ||
* http://www.mpiblast.org/ | * http://www.mpiblast.org/ | ||
Latest version: mpiBLAST-1.6.0 from 2010-07-13. | |||
==ScalaBLAST== | |||
Novel implementation for clusters, requires MPI. | |||
* http://hpc.pnl.gov/projects/scalablast/ | |||
Latest version: 1.0.640 from 2010-04-05 | |||
==CS-BLAST== | |||
New protein search program claimed to be more (twice) as sensitive as blastp. | |||
* http://toolkit.lmb.uni-muenchen.de/cs_blast | |||
Biegert, A. and Soding, J. (2009) Sequence context-specific profiles for homology searching. Proc Natl Acad Sci USA, 106 (10), 3770-3775 | |||
Latest version: 2.1.0 from 2009-08-17 | |||
==FSA-BLAST== | |||
Fast but not tested/popular implementation by Michael Cameron (ver. 1.05 Released: 8 March 2006) | |||
* http://fsa-blast.sourceforge.net/ | |||
=Hardware speedups= | |||
There are several BLAST implementations running on FPGA processors. There are also projects porting BLAST to fast but not mainstream hardware, starting from Cell to GPUs. | |||
==DeCypher== | |||
from TimeLogic | |||
http://www.timelogic.com/decypher_intro.html | |||
==BioBoost== | |||
from Progeniq | |||
http://www.progeniq.com/ | |||
==Other efforts== | |||
* Mercury BLASTP | |||
* CAAD BLASTP | |||
=External tutorials/courses= | =External tutorials/courses= | ||
* [http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/tut1.html Tutorial_1 @NCBI] | * [http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/tut1.html Tutorial_1 @NCBI] | ||
* [http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/psi1.html PSI-BLAST tutorial @NCBI] | * [http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/psi1.html PSI-BLAST tutorial @NCBI] | ||
* [http://www.ncbi.nlm.nih.gov/blast/tutorial/Altschul-1.html Altschul @NCBI] The Statistics of Sequence Similarity Scores | |||
* [http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/information3.html BLAST 'Rules of Thumb' etc @NCBI] | * [http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/information3.html BLAST 'Rules of Thumb' etc @NCBI] | ||
* [http://distancelearning.ksi.edu/demo/526/cis526.htm lecture @Knowledge Systems Institute] good graphics | * [http://distancelearning.ksi.edu/demo/526/cis526.htm lecture @Knowledge Systems Institute] good graphics | ||
* [http://www.geospiza.com/outreach/BLAST/ tutorial @Geospiza] | * [http://www.geospiza.com/outreach/BLAST/ tutorial @Geospiza] | ||
[[Category:Protocol]] | |||
[[Category:In silico]] | |||
[[Category:Sequence analysis]] |
Revision as of 05:28, 4 May 2011
Blast most popular DNA/protein sequence search algorithm tool. See also Wikipedia:BLAST.
This tutorial covers previous version of blast (blastall). The newest BLAST+ tools use NCBI C++ Toolkit and offer new functionality not covered here. For detailed help on command line blastall switches type:
blastall --help
Download blast searches results from here
BLAST input
- sequence as FASTA
>MIMI_L4 complement(6238..7602) MPQKTSKSKSSRTRYIEDSDDETRGRSRNRSIEKSRSRSLDKSQKKSRDK SLTRSRSKSPEKSKSRSKSLTRSRSKSPKKCITGNRKNSKHTKKDNEYTT EESDEESDDESDGETNEESDEELDNKSDGESDEEISEESDEEISEESDED VPEEEYDDNDIRNIIIENINNEFARGKFGDFNVIIMKDNGFINATKLCKN
- accession number (web only)
proteins:
AAA68881.1
- gi number
129295 gi|129295
More about input formats is @NCBI
Databases
Nucleotide
- nr - All Non-redundant GenBank+EMBL+DDBJ+PDB sequences (no EST, STS, GSS)
- month - All new GenBank+EMBL+DDBJ+PDB sequences released in the last 30 days
- est - Non-redundant Database of GenBank+EMBL+DDBJ EST Divisions
- est_human - human EST sequences
- est_mouse - mouse EST sequences
and many more..
Protein
- nr - All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF
- month - GenBank CDS translation+PDB+SP+PIR+PRF released in the last 30 days.
- swissprot - the last major release of the SWISS-PROT protein sequence database
+++
BLAST algorithms
regular BLAST
blastn
- nucleotide query vs nucleotide database
>DNA_seq1 CGGGAGGCGGCAGCGGCTGCAGCGTTGGTAGCATCAGCATCAGCATCAGCGGCAGCGGCAGCGGCCTCGG GCGGGGCCGGCCGGACGGACAGGCGGACAGAAGGCGCCAGGGGCGCGCGTCCCGCCCGGGCCGGCCATGG AGGGCGCCTCCTTCGGCGCGGGCCGCGCAGGGGCCGCCCTGGACCCCGTGAGCTTTGCGCGGCGGCCCCA
- select Somewhat similar sequences (blastn)
- use nr/nt database
blastp
- protein query vs protein DB
>MIMI_L4 complement(6238..7602) MPQKTSKSKSSRTRYIEDSDDETRGRSRNRSIEKSRSRSLDKSQKKSRDK SLTRSRSKSPEKSKSRSKSLTRSRSKSPKKCITGNRKNSKHTKKDNEYTT
- search nr protein database
blastx
- translated in 6 frames nucleotide query vs protein DB
>human_genomic_seq TGGACTCTGCTTCCCAGACAGTACCCCTGACAGTGACAGAACTGCCACTCTCCCCACCTG ACCCTGTTAGGAAGGTACAACCTATGAAGAAAAAGCCAGAATACAGGGGACATGTGAGCC ACAGACAACACAAGTGTGCACAACACCTCTGAGCTGAGCTTTTCTTGATTCAAGGGCTAG TGAGAACGCCCCGCCAGAGATTTACCTCTGGTCTTCTGAGGTTGAGGGCTCGTTCTCTCT TCCTGAATGTAAAGGTCAAGATGCTGGGCCTCAGTTTCCTCTTACATACTCACCAAAAGG CTCTCCTGATCAGAGAAGCAGGATGCTGCACTTGTCCTCCTGTCGATGCTCTTGGCTATG ACAAAATCTGAGCTTACCTTCTCTTGCCCACCTCTAAACCCCATAAGGGCTTCGTTCTGT GTCTCTTGAGAATGTCCCTATCTCCAACTCTGTCATACGGGGGAGAGCGAGTGGGAAGGA TCCAGGGCAGGGCTCAGACCCCGGCGCATGGACCTAGTCGGGGGCGCTGGCTCAGCCCCG CCCCGCGCGCCCCCGTCGCAGCCGACGCGCGCTCCCGGGAGGCGGCGGCAGAGGCAGCAT CCACAGCATCAGCAGCCTCAGCTTCATCCCCGGGCGGTCTCCGGCGGGGAAGGCCGGTGG GACAAACGGACAGAAGGCAAAGTGCCCGCAATGGAGGGAGCATCCTTTGGCGCGGGCCGT GCGGGAGCTGCCTTTGATCCCGTGAGCTTTGCGCGGCGGCCCCAGACCCTGTTGCGGGTC GTGTCCTGG
- search human proteins database:
- BLAST@NCBI ->
- Human ->
- select:
- Database: RefSeq protein
- Program: BLASTX
tblastn
- protein query vs translated in 6 frames nucleotide database
>Q9BDJ6|GHRL_BOVIN Appetite-reg.hormone precursor MPAPWTICSLLLLSVLCMDLAMAGSSFLSPEHQKLQRKEAKKPSGRLKPRTLEGQFDPEV GSQAEGAEDELEIRFNAPFNIGIKLAGAQSLQHGQTLGKFLQDILWEEAEETLANE
- search non-human, non-mouse ESTs
tblastx
- translated in 6 frames nucleotide query vs translated in 6 frames nucleotide database
- nowadays seldom used except ESTs/genomic sequences of more exotic genomes
>gi|50539273|gb|CO636075.1 Gregarina niphandrodes GCCATTACGGCCGGGGGAAAGAAGTACTACCAACACAATGGTGGCTGATGACAAGATAATCACCACGAAG GTTGTTTCTAAGAAGGTGGTTTCCACCAAGGTGGTCACCGGCGGCGACAAGAAGAAGAAGCATGTTGTTG CCGAATAATTGATCTACATTATTAACTTGTTCATCAACATCCTCAACGACCTCATCATCATCTCCTACAC GATGATCATCGTACACAACTTCTTACTCGACAACTTCTCCTCAATCTTCTATGATGCCACCAACCTCTGC TGCCGCACCACCACTAATACAATTGTTGCTCGTCAAATCCTCAACGCCGTCCGTCTTATCATCCTCGCCG AACTGTTGACCCACGCTACCACCAACGGGGCCACCGCCGCCACCCACTACTACAGACCCGCCTACCAACG TTGTACATACATATTCTACATCATCAACGACTGATGCCACCGAGCTTCTTTCCACGCCTGATCTACTTGC CCACCCAACAACCCCCCTAAAACAAAATCTGTGTCCCCCGTCTCGGCCCGCGTATCCAATATTTCTAGAG CCGCCCCCACCGGTGCGGATCCCCCTCTTGTGCCCCCCTTCACGGGGGTTTATTCCCGCCCGTGGGTGTA CCACAGTGCCCCACACCTGGTCCCCTGGTGCACAAACGTGCTTACCCCCTCTACAC
- try blastx first (no sensible hits) then
- tblastx vith non-human, non-mouse ESTs (some hits to other ESTs)
megaBLAST
- very fast search for highly similar DNA sequences (95% or more )
- good for:
- cDNA vs genome (same or very close species)
- splice variants of the same gene
PSI-BLAST Position-Specific Iterative BLAST
- starts with a regular blastp search (protein query vs protein database)
- uses best hits above a threshold (E -10^5) to create alignment and compute protein profile
- uses protein profile to perform next iterations of search, adding new best hits to the profile
- very good at picking distant relationships between proteins
>X.trop_syngr1_NP_001016195.1 MEGGAYGAGKAGGAFDPQTFVRQPHTVLRMVSWVFSIVVFGCIINEGYINASTEAEEHCIFNRNSSACAY GVTVGVLAFLTCLLYLAVDVYFPQISSVKDRKKTVISDIAVSGLWAFFWFVGFCFLANQWQVSNPNDNPM NEGADAARAAIAFSFFSIFTWAGQAVLAYQRYRLGSDSALFSQDYMDPSQDQGPPYPPYASNEDLDPSAG YQQPPSDAYDAGSQGYQTQDY
- run search with regular blastp, observe hits
- repeat serch with PSI-BLAST, run 3 iterations, note novel hits
Command line BLAST
check first if $BLASTDB and $BLASTMAT are set (it should display these names sans $ signs & pathways):
env | grep BLAST
If you get a blank and these are not set in your '~/.ncbirc' file (tcsh):
setenv $BLASTDB /path/to/directory/with/blast/databases/ setenv $BLASTMAT /path/to/your/director/blast/data
or follow instructions for creating '~/.ncbirc' from here: [1]
to create a database out of your fasta file:
formatdb -i your_multiple_protein_file.fa -p T -V formatdb -i your_multiple_DNAseq_file.fa -p F -V
For more options type 'formatdb -h'
- nucleotide search
blastall -p blastn -d ecoli_nn -i my_nn_fasta_file.fa -o my_nn_fasta_file_vs_ecolidb.blastn_out
- protein search
blastall -p blastp -d ecoli_aa -i my_nn_fasta_file.fa -o my_nn_fasta_file_vs_ecolidb.blastp_out
Non-command line BLAST
BLAST can be setup to be queried using an internet browser instead of a command line, using NCBI's wwwblast software. The command line must be used during the setup of wwwblast, but not when running the actual BLAST queries.
Advanced topics
Substitution Matrices
For calculating scores of protein query vs putative protein hit BLAST uses so called substitution matrices. These are calculated from multiple protein alignments by counting amino acid frequences in a given columns. You can find more info @NCBI.
By default blastp uses BLOSUM62 ( a matrix constructed from local alignment of proteins with similarity 62% and better). One can use BLOSUM45 for more divergent sequences and BLOSUM80 for closer related ones.
For very short protein queries (15 aa and less) use PAM30 [1].
See also: [2]
1. Jonathan Pevsner, Bioinformatics and Functional Genomics (John Wiley and Sons, 2009), p110.
Word size
BLAST uses 'chunks' of a given length as an initial matches between query sequence and putative match in database. There is a trade off (sensitivity vs speed):
- shorter the word size, more sensitive the search.
- longer word sizes, faster the search
Typical word sizes:
- blastp: 3 (default), 2
- blastn: 28 (default), up to to 64
More @NCBI
Filters and Masking
Input query sequence may contain:
- repetitive sequences
- simple i.e CACACA, proline-rich etc. (filtered by default by DUST/SEG)
- complex i.e. Alu/LINE1 sequences (filtered by using "Species-specific repeats" and picking the correct organism, if available)
- CAVEAT: transmembrane and coiled-coil regions are not masked by NCBI BLAST tools and therefore will give a spurious, non-homologous hits. You have to detect them and mask them yourself.
- custom filtering (lower case masking)
By providing query sequence i.e. genomic sequence with EXONS as capitals and introns in small letters we can search exonic sequences only.
Filtering blast output using Entrez query
One can be interested only in blast hits from i.e. specific organism. On a command line:
blastall -u "[Arabidopsis thaliana[organism]" -p blastp -d nr -i my_protein_input.fas -o my_protein_input_vs_nr_Athaliana.blastout.txt
This can also be written as:
blastall -u "txid3702[ORGN]" -p blastp -d nr -i my_protein_input.fas -o my_protein_input_vs_nr_Athaliana.blastout.txt
BLAST implementations
Read:
- Cha, I.E., and E.C. Rouchka. “Comparison of Current BLAST Software on Nucleotide Sequences.” In Parallel and Distributed Processing Symposium, 2005. Proceedings. 19th IEEE International, 8 pp., 2005.
Most popular are WU-BLAST and a distant second MPI-BLAST. Things to watch: ScalaBLAST, Grid-based implementation on one side and FPGA/CUDA hardware.
WU-BLAST / AB-BLAST
Often faster implementation of BLAST algorithm from Washington University.
Program was licensed to Advanced Biocomputing and becoming AB-BLAST. Previous licenses are still valid, but WU-BLAST versions except an obsolete 2.0a19 from 1998 are unavailable. Latest AB-BLAST version is 2009-10-30. Licensing is here (1k$ /year/lab, free for personal use on your own computer).
MPI-BLAST
BLAST implementation suitable for clusters, under active development.
Latest version: mpiBLAST-1.6.0 from 2010-07-13.
ScalaBLAST
Novel implementation for clusters, requires MPI.
Latest version: 1.0.640 from 2010-04-05
CS-BLAST
New protein search program claimed to be more (twice) as sensitive as blastp.
Biegert, A. and Soding, J. (2009) Sequence context-specific profiles for homology searching. Proc Natl Acad Sci USA, 106 (10), 3770-3775
Latest version: 2.1.0 from 2009-08-17
FSA-BLAST
Fast but not tested/popular implementation by Michael Cameron (ver. 1.05 Released: 8 March 2006)
Hardware speedups
There are several BLAST implementations running on FPGA processors. There are also projects porting BLAST to fast but not mainstream hardware, starting from Cell to GPUs.
DeCypher
from TimeLogic http://www.timelogic.com/decypher_intro.html
BioBoost
from Progeniq http://www.progeniq.com/
Other efforts
- Mercury BLASTP
- CAAD BLASTP
External tutorials/courses
- Tutorial_1 @NCBI
- PSI-BLAST tutorial @NCBI
- Altschul @NCBI The Statistics of Sequence Similarity Scores
- BLAST 'Rules of Thumb' etc @NCBI
- lecture @Knowledge Systems Institute good graphics
- tutorial @Geospiza