Talk:20.109(S08):Start-up protein engineering (Day1)

From OpenWetWare

Jump to: navigation, search

TR lab

Team colour Mutant 1 Primer 1 (forward) Mutant 2 Primer 2 (forward)
Red D133R GGGAAGCAGATATCGATGGTCGTGGCCAAGTAAACTATGAAG D133W GGGAAGCAGATATCGATGGTTGGGGCCAAGTAAACTATGAAGAG
Purple Y64P GCTGATGGCAATGGAACGATTCCCTTTCCTGAATTTCTTACTATG Y64K GCTGATGGCAATGGAACGATTAAGTTTCCTGAATTTCTTACTATG
Blue G98D GACAAGGATGGGAACGACTACATCAGCGCTGCTCAGTTACGTC G98P GACAAGGATGGGAACCCCTACATCAGCGCTGCTCAGTTACGTC
Pink G96D CGTGTTTTTGACAAGGATGACAACGGCTACATCAGCGCTGC G96K GTTTTTGACAAGGATAAGAACGGCTACATCAGCGCTGCTCAG
Yellow T28D CGACAAGGATGGGGACGGCACCATCGACACAAAGGAAC T28R GATGGGGACGGCACCATCAGGACAAAGGAACTTGGCACCG
Green Y64D GGCAATGGAACGATTGACTTTCCTGAATTTCTGACTATGATGGC Y64H GGCAATGGAACGATTCACTTTCCTGAATTTCTCACTATGATGGC


WF lab

Team colour Mutant 1 Primer 1 (forward) Mutant 2 Primer 2 (forward
PINK D20->P CTTCTCATTATTCCCCAAGGATGGGGACGGCACCATCACC D20->R CTTCTCATTATTCCGCAAGGATGGGGACGGCACCATCACC
PURPLE S101->L GATGGGAACGGCTACATCCTCGCTGCTCAG S101->T GATGGGAACGGCTACATCACCGCTGCTCAG
BLUE N60->E GATGCTGATGGCGAAGGAACGATTTAC N60->K GATGCTGATGGCAAGGGAACGATTTAC
RED G98->P GTTTTTGACAAGGATGGGAACCCCTACATCAGCGCTGCTCAG G98->W GTTTTTGACAAGGATGGGAACTGGTACATCAGCGCTGCTCAG
Yellow D56H 5' GAT ATG ATC AAT GAA GTC CAT GCT GAT GGC AAT GGA ACG 3' D56I 5' GAT ATG ATC AAT GAA GTC ATT GCT GAT GGC AAT GGA ACG 3'
GREEN K94->H gcattccgtgtttttgacCACgatgggaacggctacatcagcgc K94->A gcattccgtgtttttgacGCGgatgggaacggctacatcagcgc

All class mutations

1                                                                                                99
TDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIYFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGY
                   P       D                           H   E   P                             H D D
                   R       R                           I   K   D                             A K P
                                                               K                                 P
                                                               H                                 W

 
100                                           148
ISAAQLRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
 L                               R              
 T                               W              
                                               
                                              

Personal tools