SbpA Protein Sequence

From OpenWetWare

Jump to: navigation, search

MAKQNKGRKFFAASATAALVASAIVPVASAAQVNDYNKISGYAKEAVQSLVDQGVIQGDTNGNFNPLNTV TRAQAAEIFTKALELEADGDVNFSDVKKGAWYYNSIAAVVANGIFEGVSANEFAPNKSLTRSEAAKVLVD AFGLEGSESLSQFADASQVKGWAKSALETAVANGIFTGSEENGKLNLKPNAAITRQDFAVVFARTLDLAV ETVDASVKAINNTTVEVTFDEEVDNVEALKFKIEGLEVKNAAVKQTNKKVVVLTTEAQTADKEYVVTLDG EEIGKFKGIEAVVPKSIVLKTTNTQGKVGNQVTLTADVGVKAAGIPVTFNVDAPTGSLNKDAVVEVYTNA EGIASYSYTQYAPDADDVTVYPTGAPQLRAFGPVYWGVDNILTIEEVTTGNTLANGVKKTYKVTFKDPKT GAALTNKKLNVSFVENTNVAFNAISKATVTNPSSGLTVTPYQTTTGLQEEIQVTTDSNGQATFVVSGTNT AVTPYVFVDGSSSVLGVSTVTGTNNVTQATTANKKWEATELTATAAQVKFEGAQLNHQITVERDGEEEAA AQYGSKLNGREYKVKVLDKDGKPYANGLVNIGLDEVLDRNLNTNSKAQFANVTDGTALTLNPGTSQQGKI KLNSKGEATVVLYGAKGEVGTPVVWIDQNTSQNNQSGVLEDGEPFFKAPVSNFQYERVMGAEFTVEGKTS NQNVGTDGIANYAFALTNQSGKTLTNLIGKMTYEIRNTSGQPIEVKTPISYRDQNNVSSTLFKIEEYGSI TISADVISTSNAAFTIETAPNGKAATVVVTPSFVTANNFDASADNNLNGVVTDARDFNKHVTAPALTATF GNNKEVGTNYTGTVQYFNKDKKTITFNGKNAVKYAGESGKTYKYFGLGSTPISTADDFITQLQNNAANGS VTVTYKVVDNEVQFYIVSFNNDGAANAVKPEPTAVAPTDGTVAFTNTSFNASANQTITVTDADLNADATV AETTTVKVTSGTVVYTLTATETGVNTGVFTATLTAAQLAVLSDGVITATYEDVKNTTGSSVTRTATATLN TVVGQVNYNAAATTAYSEGNPVAATLTGTGLTQVIGGGALVMKINGTQFTTNVTAINPGTSVADSAAAVA GEINAAAVAAGIITAPATVATVNGTNNIVITSPTAAGSTVEVVSNAATGTGLVVASASATTSAPVKAAWK FTLTTTPAVGEKITVKVGNVEKTYTVALGDTLTTIETALNTAFGTDFDVTLAAGSNVFTVTQDVAAPTTA ELTVTITK

Personal tools