SbsB Protein Sequence

From OpenWetWare

Jump to: navigation, search

MAYQPKSYRKFVATTATAAMVASAVAPVVSAASFTDVAPQYKDAIDFLVSTGATKGKTETKFGVYDEITR LDAAVILARVLKLDVDNAKDAGFTDVPKDRAKYVNALVEAGVLNGKAPGKFGAYDPLTRVEMAKIIANRY KLKADDVKLPFTDVNDTWAPYVKALYKYEVTKGKTPTSFGAYQNITRGDFAQFVYRAVNINAVPEIVEVT AVNSTTVKVTFNTQIADVDFTNFAIDNGLTVTKATLSRDKKSVEVVVNKPFTRNQEYTITATGIKNLKGE TAKELTGKFVWSVQDAVTVALNNSSLKVGEESGLTVKDQDGKDVVGAKVELTSSNTNIVVVSSGEVSVSA AKVTAVKPGTADVTAKVTLPDGVVLTNTFKVTVTEVPVQVQNQGFTLVDNLSNAPQNTVAFNKAEKVTSM FAGETKTVAMYDTKNGDPETKPVDFKDATVRSLNPIIATAAINGSELLVTANAGQSGKASFEVTFKDNTK RTFTVDVKKDPVLQDIKVDATSVKLSDEAVGGGEVEGVNQKTIKVSAVDQYGKEIKFGTKGKVTVTTNTE GLVIKNVNSDNTIDFDSGNSATDQFVVVATKDKIVNGKVEVKYFKNASDTTPTSTKTITVNVVNVKADAT PVGLDIVAPSEIDVNAPNTASTADVDFINFESVEIYTLDSNGNRLKKVTPTATTLVGTNDYVEVNGNVLQ FKGNDELTLLTSSSTVNVDVTADGITKRIPVKYINSASVPASATVATSPVTVKLNSSDNDLTFEELIFGV IDPTQLVKDEDINEFIAVSKAAKNDGYLYNKPLVTVKDASGKVIPTGANVYGLNHDATNGNIWFDEEQAG LAKKFSDVHFDVDFSLANVVKTGSGTVSSSPSLSDAIQLTNSGDAVSFTLVIKSIYVKGADKDDNNLLAA PVSVNVTVTK

Personal tools